%PDF-1.4 % 7 0 obj 74688 endobj 6 0 obj << /Length1 7 0 R /Filter /FlateDecode /Length 40023 >> stream H|yPWƿsyDQPpWq 58)dʪLf/"q;'F]Uӷu@b<$tEOՌ[E׈>a#χܜFc{G^PР =`t7 lWKR&|T}\L0("J-Q:9*|Ttv*_J44tկ=k; M|@/4 6Z}_&A6!4ic <RB{襖-#;hO{Piiiy| PFMRg[=QŽ6q4Pm$7q!nIRzH#dLgٓ; 8W7mi!7Z-Jhh dm֮h~ u/;@ZC0K}S6t4w1ϱ)YYYl0< oרc40fgF1oSxcd^q8g0"{`D`y:y!)LlcafK9֜f3K튟XV9a)PvLq.Q-Vq!W0q5'wY<r;:6 qshʭo_u[޶ m{ܾu|UV[wgrnu6H4Up;]WB*EˣrnT^&)nM̎fWsg0-[q6[i*y'[iKUIit߲z-iZҤ$: c0fݲy딕m]ΕeZV~sqVR_s =){^ٱم9kGfP3Te/ktf3dϜ{Cy'ZG$c>p%^R;qǫвw*c;kpŻ2+*O b_0ӐH7ԉ. yF !oyW>e|*gx!^Wx# E0%+*S J敼W^x=p4țxr䭼0x罼>|>8 >ɧ4|ȗ2_|M .v-,͹|=y#~9Kw7\Elb68mv؂8xIA^,cՃ+1a&u4[\='<ʱ~@Acb 5[H9jƧL6SNKϠYe͛97fϙ;opⷖ,]Vw W\UTk֮[a6m޲Vlܾ꽝~]uޣ}?9pЧ?Hc_}}Ɠ=}Ξ;WzzK'l+zVO յH(D&੼k!3d˓7D_D>`vG, Y7zP0aE2jɇyiƓ;5=Ot̛`C7 7Ar&3rb(1:@%m^ԉ@ F>CW VyR:*JI4.DF"R}ډ= [\a]R12K 0;z|i0 \}.a"Nɡgk1vƗB<i8M[?MU=T/!Dp1 Wn ^4` ԛRpmjb/j Kdivj5+JWyN,RvT-zB#/1_qW nBױ?,q/ryPJI C=AquHnP>ޥxJ{ⅱl4f!nW/`' M4Jhܩc\Mji#[K˂1f| v:hNyݰT[PwX]XFp4c#c^t'Cx&E~.rEfu &(W-H("'4;l j:T]j=aއ\:n%[(.`7m9Ix,7x>D3tQ #*~qY!EQHPK]_t:iϯm펜 ! >ȴYP'j\C]UAa, cX2"1MBdL(`;`k&G5ߡX gD2@7x0>E|._'T?y"|Ds 1q^SJW5AM`SC9jz ]u$}~^:V_a^E!lUY[/DZRb:>^Y5=Fv\1Sg1MGPE67VwW6c -\gD=*]ҋ͗~:Y(?h ޅZ[K)UPR.u!;q^ jb#o>`u sNDq+bV԰-۱~|';/)͞#,?)d 8KBQ;߲iV '7x!vNlZ:A4Bi ohۈTp:,P, ~r([0Ҁ ݸX73g8N3%&3bg5bZLo)"ਂ6h 3m4=A$C [!VQ#}$ef  M.6f'8(0J=uҹS۵uqnשt曮)`)'2^8q*>1r8Mϸ_z'hDVQ;e1IɩhҌG{n'`XK7Z9%t nWl6_szg4] zfa7X99CRZŪu7Yhǚ%%Z-===ӂ4fn4TBf0άsRc}PC)3=m)+cr&2ct ĸͰqԢ%V\ȨHN}7- иOئ;~w=ر9$yc8s%!$B1;'!uNbP: i`IuTX[A*mj4eRcg߳Ѥi/}}w-0qpa[ s#H Uf)g]IԤiHC`\$8p4r5ǝ/D{-Dǁ*K5+W˦[ yFuQ岟3cѯ!ltHT@MעĶZ (^I)@.I+{=~=;K%+CeYh_~%kϧHҳWVCѺU|E}Ho*+@t?$q}i4pZ#dKj}?l4KbPm-9m[גVN_pNOj HxwRIKS+ G PO/=K=%j!$g]+ۼM:7'8񑶮D"o6Dţ$pG=I.E{ OMRl9#v:Hm=ؖquvG&ec] IS1:^ ȤJ 2!k ~_0Ij5YA-QV]a-Er2yAF@hVS4uEم]K+s8W{P5)e剌k'eH»3gÛ/aTHU6y`8ǔGعȻ2 \:-z0i"?Կl"y%: )_J6 Xv=&gafHק1l-ج"B?9W&Pfлps{ɼqϗo0TY !ZZ)׮9 ,P5Iy@**p°-ca7d$Asfy8?2sn ei}dB}qߘoڧЃ#.G3I oOϧYzJKJ@*']VPXPT ѫ9BԇW+j.1˶>Ã)d1pMV^[#;իk&H\ S/}Fsh(4TV.h8w3sNCCa2B[s8)W<etVz66I$bCQ ²1BD}rrB}>*n`I}1$1c@(PDO0ՉHD`p w4T|=ʭ3kekqw|7ot{C/dU+N|+s58'!)5w9EV%Ჲ2Z=(~}co{-{zwc|D"f"i "QIA)'"$/Uk2Q|7)V14<8TP4%О.yp4MåC<,xր,GWk1O#9tMi؇ϋE(UM6AT7qǺbfC6gL{3U:M`/jX4U1ehМHT8b($MI@%JUA;(WA>BW\֫ #7>8vö9`XI90TIhUjv/[2ښqx-QvHW5c+UאOu-}Y{;L2"8P_ obҭmol6S%@ 6jۼC^]%z_Xi=9N֧c~![l>CGDl0Ot=.!Ob6IJpqQh.nRRRQƨ#?n+aM`2H(`*8$P0L1\3 {*c3hF*M r3S< S/ )X𔧗/I*P'8;܌ϝn eҤ}_ު{(f]tOo#]0W3;>ݼ6bxT\34[a/ kkUb8a <1I d8Ā",~a4ք_0ׯx*v+nq,okE:.xi RB]7Ƶ5 ̱/9v cv|![[Wy[󸧸*T,YZn+_#4Iu.@n?ϿnF׮&1wp_B=ڍrz" xf[o8vL%?ޝ;;sb;g' TMxA[mE#6R:F4 !@*hn0a+MP'hS@[ҒmQ+K!;?%|.6̊`c=8t:E:G󁫁qA.i+ǺՅ~9uE C֝뜏'i??hAR/ 9IdlCU?NCߖ,%2DI"CUC^h`޷aH!5Ж?ES-R!q;)e,gQ}ONz$TK$ O(AP\ fb8L[1~,94 %_No'o+6X^pVUїH-1ߪ ynj*d%qҘmi튯o!llo)?*|o]GJ C!)nPTf 6bbbْc]}AqD,~<8D$Ĵ8ARiJq2HkdKT)ޔya+("1\ł-ΥyƮ{&f0KRG:` n$r")|hcU5ui&S"B@fs"d^K(2bbB# I!E#PT#V!A{$PjJT+ rGй;?--$b]{)|ʤIP. t|9@Ff @+;vAQZKa?p%?}12ru4"/7$OLyA$9x>0n' l̈́-t l>OI"roA7ALeq<3qکCw>J/>:{KF܂^>4rM W}CS.7o&de]pp0 \$"eRA7rX'19Ej}7۹5 H0}> 9_w Ԩƺ3ʇ XRfK`' dŬ<Yc_l`ק֫T%(hRAhzM}Z_׶Iũl6 OXNdNfG3ו4P=k #f>LT.(vJ(NI>pӄpzhrR !VYɑ1&h# '9so4&X ҙpcۺ9urs7εNr]w>&[S5mitB+MRQRom7-xHM6K+G#?*DLj$9N&%=}/YM֜=tL()'Ʌ9yot [ `ejYOijjcMI/p}i hSu59wKoePk=hk . ]{B ^hb[׵hYSl;Y+sN ,]6lc}Ú4Rjhz6^z=_#RE-i 3k)U֨3fjJ5%ݦv? [~_ £G^?9ҏ=Wӧpt}#c;6KƋ/\X{z9_$EW,3&I|"JjKe4 i1 f[<;7Q5onZzL?3Q-H' 6J=H@R>IgT` q@=8AHf5js5mep@sd1VO7sbOKis:"S}T&pc7 wygn_2Q*hF(L+jH8LfL7RfPkر|fbɲC;󏜸@0!ǸQe 7\P3RtFԊ: uEe**VE2I"5@z>#HQ W +{_k;D.͊ӻe|o %$hvP۠QSeu]K؆FOm>D!6 $jO%\(7xrpq5tz5A078W'^mu؝?_Z_oWyӅ-<"z(ެՌTfY*,֫۸Qe\a8 OJ#0}ke +!(Y%ca!NNv }C (K[7ފwK{hT>z=園^gsџUww2\{\I]rN_.! BӀQ0HYTȾʴ\WšށtWq۳TFKMʵ Qh)411?3ǯ kňYMkaKu6qw?9ϾKI8aR|ŁP,)!uZ7q֢jE6PhdLj#vc:H+JiamL6mihR{Pݽ{WX[g~hZrRiR..SXPs)uVVSvQ<ֆpD` A".{םrW3V#2&nfŚimM#Ħ^_y#;O ~y K]TT= :}m~B(XV4ePQP&(ؐ(aivG'G+##tyo(@!P6BK$X8s*'xKQH, `#0`!;]q`u3Czw|B$xu!'tqTZ/AṇLȖxKf87:#5bPJkV-žk]zj5'SB5gtv(zu4¥f{Tt7:U5Ш=:B0%TkN$B=aN kcY iiIkɐ^g/𮥕RJ;Cv %B2G$?58'6FbbBD͖%FlRb Lh) q!3r\kϺHɶaX[\70x v%a͗·KoyzmC˟PwTU_u亿?egW5; $$J6ցd8FQ$ rA }Y`(B?ܿJG@{$uv;%AUR8P}(u :buN9 "y@ , 0#HxROY%`i$O($MX-[ ~Y DKKW\aW+yѰ*k~ifs!2+[CD"Bb ܒ^kImvOV^?μu~O̧]濬[XݸweNya$Oxȓbui1}ֽ(3NO[O*9#-]G\0L"ٻIش^<(dn% iʩ/&ᚱ]ɑ=~‡>/6]gLiqRdxSdea%xK3ʡq+6a(iɐz$IK첄%2+TV ]+eb[%Ke"4RQ|"TPjkC.3Ly:y$9!ʼn3W>ͼWVzeH֜*{s^ݕR\%>hC)D"aP/:޿#ɐz卟ϻo^Z9aZ{3>y}O`g67?ԍg$^% ";I$/eǢԄEr IPIOEJxJ=O\[wsR_|efF+[xOƛt.mFrؽlK/vw_D['Xsܼ7֤ݪ*G_LAU/j}Z)wrf_쥓x} ^sks L8 fc%+ @PPMW#BF9=vxj TM[jH|*C (Q/?_,x 195ez .lXÖ Yu=P6AZkt= 3 9?R2OGxb*7[*)گ@-W,4ҔJSZ* 6hڀts1bggdCEdP-@< lOQ|>Yn>e 1;XWV烊ħ̍:g8P1?Z/~Ap$fŬǦ[7'MDѹ4P33Ag Gr@X;ZzbKCBK6zy!Tb.RT2ycխ^+J| XFL煥 2%>GF >xk {{z޿jzhW iuC==Ɩ~ Gޥ%Q%jܟ*PQl  !y-#()1pu/,4EaSz[A{kGxdh$胰h}" D u>*tҫXExtÛDMSbCY甅eJԔЍA>!!;ӲDXa-[`4Tg! #LiȲk:au Dgt-@\)VdY Z!Cfê+.clE\Y1 ]Rlb11f6XuZZI,Y5K y=oCguĐi}tُꨂ8:$3 F3& i?(L"a@u\#Yo9p9/#) 6O%q>dQldI-FK$IUmEȑJrI]U?W-*jOqr(SRNsꂺ^vI1=bK|Β7 [wJa$\atIbS%dQN|w>(xFrX y[&?--miCE ߕWWmO ׇ=qڠYF&?ٞ5ٞ=f/Κ,K4D@)PJUZ֗j;4cvܪT Znr#/tbG^epgӉ=8O% N4cbx(GC ZreV mcL'NǀQ)={ѾiCu ف-i[9H)+V4Xgg}!܀:]o36Ctj?T2e!ޣ $#0ݕTi3y,;ߪOgYmg4Mjcf#q rDy0DJr86j/OfPՠ5-kr;<[/<)åxMRjrA^SFks3hk6ꖁTM!VU.;$O50D%˔ (Ҧ'h%Vgf?NW0-S0 qYoY4jHNGns i$فvQ=KAߗ D[CF&m8`_cgMȴ"HL!k ] u)"v)Jn 0ui0Lz.t$'J75w x ;r`NasSBn)g&0ڋp-rrAj=^MOGD= 9$KHfwˎc1P}Id"s E(+ 3Q}JtaQ_җu :w@s ۔_mW =>ʔ]nMHt[fvC/a`&)7 d'&`U~˚rfv5 ^s!jN:]Ɍ;Twk>B3>NzfxV C١{gI&'}`S" H\E#ӵg?WU~>]Nc۱G9N59!:e7y3t [0',K²`K& E(q&"F,zsGJ}W¾UN#81+.hrdB[nA cᮄO;~ۧqaԘZNYc! NU㺭pj  ~P&fL L+ʉq?fG?s#5Yf%sccju!&A9xn_}<;_;Ͳ߿rSм{ߚcQs}Z6Ldլc/BvsE{5뵶_#Dd,FnU1p5l$0G,1@'0,8D$-]]ob]|u &t8 ;`w[/qWki 7"+ɱnlƉ .-fd-\k-Q}Q@7=R**R/y^J}G<9x~O|љ.̌4F_-z6:~?w|wgw8IUZ-@Au0(kj*( $ RT-C u"(EQ?5SЦ$|߳!w}C[\Y)2'$9U> gRs4W.p wsN06gLn"͋抹j魿 3DŠsmhoͅbeD&(bCmTF63g3aUPU}cE݅.\L5ơjtG!L@]C#-7~c}cᘽPXrDL% c9{GZ{tDxp5ɠ(?t929Oox"C}鏳)NZer]"9W H豐E,'z}=ߠc̄0utb4tKD$2JT [u:m1VΫT 6bw=c^. >X@I C$g3~@܆w.1]/?|XZJwNak.S@Sc,W&eYƎlIq|!6DR>E?O2 >AyzPZuՍy |jO d|׉ϭa}_܁[0^5+?qHl:J\>2 x9F2ŪT4RG ~Hk-ShlEWt7Dž!/k K*I7:FL!TO%$Jf Mk3I<5ެ@*BSun]k:|wæ`B4)taYFϸiwݙDǒ_NɌ#| E$^ӒpcY.5;mVEl6kbSa-IeK9V“dntuZzjs@WWt3_K7]7S7oxiT+=1pt1H]뉳 4Wz)6DR"ڧhOOR1++MTO. 4uz١$uN"UL])7 JROjD̀'+Q/0MBO.Kh^b#||>ҀLLRs`_IU*-K$6ھj#i(q0z˜arv.H~1) \/mҨvykYSͯdȝZ[Hd #0M1:R (JL 0EcoKX@ib԰^4Aϛ٧O}ꕯ|L3#<񷁁gD\x |,/9S INC{G]f pXx6+Tw9,Ha}&(ޯ`GdIW&B&76MOG,~~|̳%!v5P|BPVj d'5FRnԑ{>nt:*t0(xFd;{q&M">)?|p>/qO]ma羾Z-YDb^k%*ᷧM-ԗ#/G-ջԇjh?O@^(D#1W vO 4GoDތa"Q|vJgwr2ˈE"oy:=NXޡ <v} K؆5IAg6kI0ℐ͎Rc[о׫9s{JwɁXƟv|r{>whu(y3cXiHT*j9=@l,7rqnXsdb52QxԃK йs OҽT2*R _ʍb (q}V4+7^fgXxWL V,#q;  ҈8|MX6k,== C<;{de *?H8 $F ` +(A& E5oѷ{[c ̉dJM; >6.GCwŶq]yCHqn3EuD 4[҅%4 "S.ڱ rQ8J*ФM@6 ԋjYT GmJ0֢{Pj.;wg8۽r I~G|Fs!Csw-orf%i, { AM:m3 LҧAA14ߚD\WO!8#1!g $l`ڨ$b1QwCm^+[#|*ҧ:N?QFǛڇ\/nܘ3wΠWWc(3c}0!G G5n.`̨'C>ݹӬ"TlʐLp8|}Gpao 4;׌KNk7׊ϑ'pܭK>+MUa+ NIYYS4mҐlRCʣ)+'csי׸s9[e@+ʯԥr|ܓ0g>i:h u1Y]].f2]E[-%n$dOktgӸĔo<˩[y<2C ӒD$Ts"VMVALBf1{z8dA lQ@$,# Mp&T~]~ ;1zy+~.-_/it&}>h(*aLLmSP7 |W]8)u[')tԌ,;j >krNheEz@^^Y,K!-9 l U$j&ǃpHtV*eP>uQΗ6a2Rs5'V]/Zfa{Gr1G.w"`%0?C>dtfE,v=4ۛq39OkF%hw60+g̛wwk/IΗOUoQ{MwSh#fm6 ŝ=}{V1Xw7-LӑK9aN|U^'n^E'})D+ "4Ňc:uA#FNTP7eÔ=$ˉ].7h?Sjf*fމ^ޘ3{:eM4-k@^7-fHED'1*363A%W.۵Dž^=e!7kBGt}j~2GkzNT2qMQDL_(Қ)PL&)Q`^SBK/X-e] V%/%/"n6c3 v|Tq ́a5pSZ!p&a[Ҝc;nc&0(;%{"V:Zە6ΦpD^N6MPXVBS&mZHUN>0W=qۊ MV0h[aӨA_[_ru8y _:+wkt&Н[б^[ ˆB!-(6v 0L[]v`.؅#lW3Ga/]+_8զ Ӯd]H$NYU^٦qP /2yT=:n3VR羷TßG媐>zNr.9=jgԐ+ ٬;xC;;]wlz@;sRGz\61DItB4:auqK55+[Il0>[EUFzm\ ^>L_:>XHZo`+`T`f9g=,nS8!5RV#.Y]Q|<|I=;Z<ɝ"goN_ /(/3/7<PQ( BŷX<):8@BC05qM)ajJNf4*,Au>Ij0v)V¸k4V=\Dbz!WwoiOlLsƪѥ"6Օ +pTk ٴzu|0™pzX|~OL$+sO)B9'N/a_/H 4;9v ~Ō>+ 1Q;!Nrs" ټC;@H M,BB BZJ u+2Ƅy(`C)(N h[˫VL~g.˂439߯2&V2d ,%eKW(yWr{_4rrsr*]!ӛ-J_4ZkRXtƴZGrO'r\67Hod{J=c=s.&v|S/~M} =f} MLř>$N_hh疞QOZvk@*LAZ([hR4ЎRbE?wSX?{A I+Ы* R󤞜  UzAjb>8ˡU)[}'ְ.Cޛ4`Ӣ+{5}\N:0ƙhtݫMfz#֭X mDGO/NP{ӣŤ;3H?m}^/3ҿ~CW[j?YNZ#!6%ݢΈ JwmTgd$z5h_'&/B}:K9 &xװki 9FPΗi\J(qE& E9}EL=h~S1o)DZAhO:3dռ2q?W!k)hr5ŜѺ&(WlQ5w`|,t$u}c!XY$Nh qJB&֟u jYH)XWnG-VwT[7Ghb^B9ߖD5er>1 :o* Mknբ|+̧1z9:+(梉^7 ` 7C͟OY,c`焳Os s1:{~O||Zc cϣo9X RѿF0|39 =Pa;) zL?1X7㳠Ǔl3lllaOflƂ>3}=@huuf_ٶf, k;٦"dQV>ȶ!Y "G E3%[:B.M1>f9(?9YE Wn%Qjbeih족2Y 3vlQ'z^̤v[U^#ҏ $lG6w-)im$@%Oy?(T>5AI^ U~ -{ &*_FgF(sFe2[b-?Ŝ5*>6*Rq};2X7y@D~zJB̝D-b;NŠ٢>84C cMRHncmɱuܕmW( 6. 5bLVmT"`-{1%HCc\jcx/@ 8Pnkڦ+SsGyu`ګF:Th4Ի"T&(te"G!_!?q``]j%*߯P<(Y=}6ʲpFa&^:aWWP6M>=h O+-ac71ho>i8PL@]a/2R?F@m>߁$?m\ф}qr$oAqt}}n3NsfMo4>i#>}h}Ywv;Uϯqf^z|'[zZ;p/AtGhh`_kP#CQqXvǑyEvޟz⭇}Xo?}1q|D'sD1ONt~;{[>bDn!!%_*?ݥ.uK]Rԥ.uK]Rԥ.=R!izii_oA}x&w>ҿ{|ոFI^ҳ>>aq?hz_xݓX<@{g-*7/޶x+Qqo^~Ƿ^[ƿ :^0+o,o[ xvZ<@;}A:7~o[&ey}GjMzil0x=xx=4g#Fdqxk1bň[#F{R>b#F1zy'k1b ?3ި:p&mˁCwoa1ֶ$x|c,;go2cn{y;`d<Ƈ??156?Ømc)-PT%IEr]Ы<_F=ĎtO X_}! 0?4|4LTkݬw&?B-:3>9%yȋAp.N>+2"Q yL Juq"KVh-&iN/B޽?.&+1z 4.zkٯZC=OBj̺\L #ubl㾣$WgJu}9!a*-8<>aYd69h?C,ڵB{moe~Li7qe}==Cr[R6YWW-7aò<3Mf Ǩ^s)!e(Te=l|ZM&OAf]-/rՅ%:4>2*MjhR&][5#tsam5f;˙c:jo!&<{Hf9%&;2}7dz۲k- l֕9]W~9Ku 8+M<.(`Z#o,-LƦ98WhXeIްi@/)^s}PT==HUImR49g8|9ٌٮ3+>k@륟bze3Q5\s]ΑH{bk+<~tg ggW}<ʹaR~9 ˍfg^.ۊolr+~ tMmRT>*=j0Zk!yO5Y% ܽ}su癘WLnL?]TRfK'E.1IӚ]g;ʯ5;FF&wv2{ʬXokTs[ }iƊX8 M'tX*{ַ]d-16>^ʬ{Ǟ6U~9Zeu.YSw YOoK˘u*H{^kd]ck=FlvWl47UU9EaWF. .Xcv.Zdm_g9%aP>LMJq42$v/TiĜe.>-/\緂}j$N`I%3dTF :8,GuzՉ(U8?~WɊn=Bɒ'RIOH0ڂs_/bN8'dzrMIDTRNȲRNKz G!IĬ<&pcCSHҘ}'©Vcu]e QPS(bzwOD݉'cJ/'L"ĵB,o֠CF)PjyH^,*k+X X5*>!M+J~3Ǣg j'r/<|%]D'@>04 !4HERqD$aQH -ED0[inhϥ":1|i%tVqx.]s zTUΕ q B_֫:އd{1c -[lK- hw̬ٝ{o'$9!Bz'Bz y?ZGh|En.U;oWȷ PVY~6a^2?8p-jʳf^vMR;! \f5Mtl(IHm^URN>eMsDrc+& Vib r]j9l%QsKaSqF:'+ɢ_]znXT, w)*uK |120NE!'P9AXesX3rAQh5_cO:&վFV/8>VFŊɁ緬 {h0=9Ee޾V_5ݽ݋O^߷۰}g~ez$-~n5%~7) GU{oힶ{k{Ns;;eڿ֖nȮt_rouI4_xjG=Wp{ύVV& iUS*ѕ6dtU>!BO+HcP\詅- ʂ~n_z2ۻ -npR0##2DSj-y ]?inZZuҜeȿ.}dk[:><^JI]+ed:QMqn{l*Cʶ zLgJ@г֞c,={+qǝo,H,X|55'c+QʋL1eCyHŚS4{B ?i<.+/Y2PDe+Yj(9A&όĚ(>u^+N7>5,O^# Bȥ""+K#1*MZ2th9$QWo͊LġHUlfѬd$&ց;H.XR\Ʒ/gXx ߟfef270772+7 \͸ Wq wAئ!q;#s-[W8c&Ms޼7&܌[UZNb?1e[(,s0GQx4ncX<D< OST< O3L< s\< Bb"/Xwx^x^;o]x =x+ކx'ޅw^܇tޏ|‡| |§||_—|_ |·|?ďc?s<_~~?AONN:N :΢:ΣEdR.K2ZFii5EZK먗꣍O 6Ut5]C6!4BIhh )ݴtH7t [ɦ,(OP~:@L>U RDUDz 2[hCHINýOk[unzXOe~@dm a6FHemq6&DdmMi6fLem͵y6B[dm-eVJ[yZ[gmmMٶVfm]^gCv؎Q;f턝SvY;g]KvٮUfݴ[v]g=G؞S{f텽W[{g}OپWf_ A"*!:b &b!6 .!>xBB$Bb$AR$Cr@JBjAZCzIȀȄȂȆȁȅȃȇ(((( %PPePP7**TAUTCu@MBmA]C}4@C4Bc4AS4CsZpZ ` n!N.n^>~A!aQ15 000S00300s00 K˰+k[۰;{ppGpp'ppgppppWpp7ppwppO/o_?"Ͻ$Ea2*1:c0&c160.1>0!110)19S0%S150-1=30#3130+1;s0's170/1? 0(8b d)fe9g͊UXX5XXuXX ؘؐMؔ؜-ǖ؊نlv b0C@7vd'vfve7vgd/fe? 0(8N$NN4N ,<."..2. *:n&nn6n.>!1 )9^%^^5^ -=>#>>3> +;~'~~7~/yQ#o(|U]1S[qW_ PXITɔ\)"M*R+*+2*2+*+r*rGV^S~PARaQQSH****ieUI#ͬjjꪞ꫁R KZmj +Djr+LPGuRguQWuSwPO}[}W_4P4XC4T4\#4R4Zc4V4^4Q4YS4U4]34S4[s4W4_ PXKT˴\+RZkV^QY[U۴];S[{W_tPtXGtTt\'tRtZgtVt^tQtYWtUt]7tSt[wtWt_PXOT\/RZoV^QY_U]?S/8t8Dq|N4'ÉCv8qxN|'I$v8IdNr'Iv8itNz';$4$.0apDmU> r]ޥ[]]~S:uh"<(ƧO򠊟D;ȃ*boJFA5O*7|L]'Qu-#*K,ɞd7Jc6$ٝ&qe'o)RN۸pU&qstS,>ii/a=TF*9\^C^dWS9qv]J~IϲSm8˞̭ʮkkyi;u;oۡZi 辗*'e}nPmz*kdTc/iveݴZO>ve=ˏo v` =`r R2S$2va~v/U`y= O[f^doYx=~y/O 옞xÒP}>Uy.]j-hǗCxmmb]-Wy!\_Rt˝Y?6<Gԟ|%QUyj4Pɟ&No)m?t1Vh<(Lx<Ibpnϲlr[ݼތC-mv_˼ƭ],(M3$=6o'Ko#=.tst`nyw_vA{PY:-iZȷ.*n~X^ǃWT dS^.kq`vg9.;A jMs_y?N$?iux9g;<<M#~Jw)z|ucRv4ۀW>T3%Cl϶6v uS'wRy'9}kG]?h:? #қ⛢[btϺ]/َZi^U;8xcCqQ@PTxnzX^ +1İ` R} 1Xf`2e1q!XbE)VXAU-dВr,gr9#G98rp(QG8 p`spvH%@)P#GМ } O}ɧrM<Qm |/*թh)7Dfbd,pK h8ޏCؗGWIw{t*ü+VqW?z\-㜪aF.:==OяjffoE?)Ì#▮$O3/~C5Ff,/rmSsؒR>7jߎ5EiA:-:MV+jDWF>S4eM)Y|jb[&|/\:y 9ck tnttPF5TmoL67l6~Bbt@=r6Ȣ+M퓓l[IeZ!|IMX>KҤ[#?$vUjkٽ@{vTv/ ZݭJ22M w5ʀ \F'*F k](J`9`@H%@)P@J1fWSA_ iIYF5 }V_*F@4zPl1/Zxb!Vf!V7 ;{!)+\F.΄2Kʀ=W8}[[=JҰyĸ(`/H0/Zg/qWxb2/ ٟRC 5#'2q>Xa/ rAUӰa4 ZM }P!ȫ!~YP#. B5b-Z ^2pa4 ,k>@BJ *-8W@Aׂ#m TP9o".<Z!#B<|"ZQÙ2;Nls8a9nΰ\ ڢ灃# z9 1R6 <CfUl[*/_ƫ0;JxO\LL0 w:%ei=g{ fη P Uȋ+қw~+ڌ28[5{,am~#Ck.y`:$a> 9亖j3* &) Y9Hyic^n5p/I9mzKdn-y$1B@\aNbҟI%I|@ VKAo`Yu0v $/_ ~!}"}zl^6x'-ę8_U1 ~ ]Wqf#q>Gxߨ:bW0 + NoA>]>c5aUg4cN@ (7&|xG8jQ3UtFV }"pNf؉zʪ%_j-whӾ{K}^>V .ܓcTNxiA*հ(=Vu>})%q6阤gU)G UJ,H Z*4p/].wI'%J5ZG[hhk(~u02,zVD} tNE%3V2zB5:`888Zu| JX `>0ϯ|.zWjZeVUⱖ(//ORTMji̠Yc:d0YuZ-5-κ@]n֩V:/u.tLuݒl/cK|ɱIaah:X ̄9 @1<$ KJ1^/@MX| yFrSisꜷ5O׀q;qKa%>=Jp3P `NzGQ<s4WmپRԟ;w@U:W8p{;O;_wPqԐW8V= fBM&ڄ۞"UDulbC*****kUꗫXnvUGGCU{4zTS55*L'8帋M_(VܤXZmA8)X?+v_+v+vY|iʧV#-MdOup?g$o[YOȾRV&}J;!~b2z ]ԫ$ħf!z ]lSV-U'VCIU<>knB XV[myW .>N!b7 w g˫dR+2nq >KY׵_v\v?ok ~Shi+R$-]Zr[[k z:v@8*m N$ܬvPnjGʘb9HdY(*#fFIꡌzc6F`S3Cb(N(tt]zm0m;dr=I⧓OpC⛐fsnqASHGk}\(^V㥼3} \%" I1ś8+Ne$Q)/夳҈$iXJKDoN` Ѧ * w+uKOn_Z2pw^ϝ`b Yqcs[Қ/6{_BǼ}zO,c޳1(Јi= (n4hSű#EIHu$A> endobj 4 0 obj << /Encoding /WinAnsiEncoding /Widths [250 333 408 500 500 833 778 180 333 333 500 564 250 333 250 278 500 500 500 500 500 500 500 500 500 500 278 278 564 564 564 444 921 722 667 667 722 611 556 722 722 333 389 722 611 889 722 722 556 722 667 556 611 722 722 944 722 722 611 333 278 333 469 500 333 444 500 444 500 444 333 500 500 278 278 500 278 778 500 500 500 500 333 389 278 500 500 722 500 500 444 480 200 480 541 778 752 578 333 410 444 1000 500 500 500 1000 872 333 872 667 741 722 483 333 333 444 444 350 500 1000 778 980 727 333 723 486 500 535 250 708 500 389 500 450 200 500 611 760 660 500 564 333 760 333 400 549 333 278 351 576 453 250 444 954 429 500 278 556 389 278 722 574 667 578 682 611 896 501 722 722 667 678 889 722 722 722 556 667 611 708 790 722 722 650 1009 1009 706 872 574 660 1028 667 444 509 472 410 509 444 691 395 535 535 486 499 633 535 500 535 500 444 437 500 648 500 535 503 770 770 517 672 456 429 747 460] /Subtype /TrueType /Name /F1 /Type /Font /FirstChar 32 /LastChar 255 /FontDescriptor 5 0 R /BaseFont /HDAIFF+TimesNewRoman >> endobj 11 0 obj 60635 endobj 10 0 obj << /Length1 11 0 R /Filter /FlateDecode /Length 28341 >> stream H| PTG_73( x7HJXh6qZ4VBc#j&(xވȡQ[xO]LE{߼uAc2$z}GIXT&2&"677t$@1e7XNb6uQ}-?Y 藟}@7J(z`̨qmε_5gʐa,R:-&b\l^*^u4c!;bu_t7ϱ#b<8>9 9XEm%DB/S_4$ubRxɨ)u6t4hU%+촻3&F-PMJ w:)aC'$K)rEU8&UIRJJ(Si/yUwmi9dcyb6ZF[cíqi4k5zzZ05\iC :h!Zkk4me}{? :  G[G7G#hʮCMzk' =QOS,}Kߣ3f`X`F.5- u CC3.F1јe,0̾/?}Ҭ2kkHBt*eZnܛx!/啼we.Xv[ ,>09 E|&VíI-U[ܾkO棸5sѯn=k%)zf-e-[T2Fnv{+n]o F10/ܪ\P'N}K*T6ΧM#Ukeʠ6{L @tGytfYl3TGKf~$3dt5׫SNn? ppp^mL D#FeP`##01JXa&ߎTLBr)߰"$&-%%*J6*ZN+'YBAuyJZgxNiZJ ʤuEirh#mx@h mmvP}j@;iy7PC|ɏvjD)>O(RjlP3CtS zE9*p ש%id'G'(N4֤S :K<].zPJ".W+(/JMG=szATAm ^R%SAB)XXUD!ҟD=)Kx P ?@4=uMDSL梅xOB.!u(D6"HbirQNL9[Εr\"W(\-3:^fˍr)\yDS-ʋ*Kd-x(x*(+IO+6ƫy tL^Y^I6Fޤy om]9Nޥy}p.C|Q>9Op>S|ps|/EĿ(¿]| u|oq;|{|#~O)] . 6DbQ)6c b:-qKpO՘Ob.u14OB2}#x xcy*i< <ygv^.qEPD rqQ@|@(6Fk|DQԨ JPIĈZFQ4DkHHxZc[#{ݥ19=wΝ~W)WyL٢,U+hN!"cUGm /:8t٭KW%L8irZzƔ̬f[rhjn޴/ȟ9s~W.Z (\jk֮+Z_ͷJ~gͥmٺW`g{~Q5?pP#GxN>?t勦/^?߸[=a'liힰ{O($_9țH7xݳ%i,2fjw;(+tG ʢ \4RPݑCh s#O̙@c(<( u3g x*ޔL( `&OUxz/3R۔J)!A4 \wAa?j4ʠ2YQREL2͇FE˨ 9F-l-Wf0UŝBm/Ejg =BxtOa ՝'kyO@jArV-\J& ,-;l!~|-X_8"-Oi1%C(̘i1v0ʏ'-vWb=ȡ'OP$-1Pj]@Ј1FdxcdSl9/V4+AZvtЁZ ьc2_-Aa`|EJl0ʖwAOSE,i]XIF>==U0(Ű oE(U*3E]@в?uh c#XFfQ7%l3 /t|??) .?TO֞4-XhM|1ZM =݃jHmh e zV7+g.ka@FDI<DX(_"9JWn85ge\.k&?n}Y$U_J$*+Xy-e\/wȝ |z."DGټN^"x!\q{(N7&Cޣ<M"[@PgoC}>N#&7e<9jE~U_S2:UЀ Ƣ]) " Zx΋/ fYWVM?%0M_ԯpox֋9~y#ᔡ~n3b%{cqr .ujd(t.6nVz rsJ1.|{ OGQoma&ES42Ȅ;KwEF-S"e0]bc!z@ޤDo5P.%#y@u7W!1TCe؋X'(a/tqYx&W*+Y:vAC.#xL:NQ9\qD< :یų)\f4-gS3<#8Z{\!l3rZ j(AE&$I47uCV9 rÕz5bK֢y8ƺA ]U#\Dh%6"lh4v9] Ƙ#:$:*"|'0OǻGw/n/wٵSGNzTgb6$XTkŪC 9!,V?%U8iDilioO!٠Z/ jHM!]>t\s\8;f&,ٚ`Fbp5.iΡ!TK\Y= 0ϑq=Ck89uBP`G`QP;V:v}+( <]1!d#3ZLˆ=FyNᗫ*B\]4*ݞ&Nĕt9M;mO|Ws+3}㗒KX mJ wt{dk"7țdfOWCyXHyp-\]uHMQUԄVeFuRbc-Ҫټ:My|>/y$* nsz3!Jq1͗-bm}י:Rw?#-,e t.w[R%pۀ`!utt*Ǎ=. hJ$Y#1MKXaDfD#]z q6%{3gLi ~ଲjDf0 (8K쓻+/)3${;+3ӳ{xSKLO<7^:sqMm}4Z <3zm|kpx'} -v vl:.3m&ʈaxv|y$"E%ѡ:(͂xw<7D'8aDl˕bN2:hgʠ(B#$҇ԛ-3 #} /.HKK1;p|ePӐkMhmdJ"V/ *}fkӈkQC@0#:tͧhπWZ;&66C7anA8jryƆM-.D#B|siwпt$凃#4~_4w񦨶mwua(Tn^}ވ9uv^m'.9ell 'H%$nE$L]vS ak="ح&qn'vbdf鮌'E$dC- A,h>L<|Y9bo$lo9 Q=e6M|%J"|xT\2 xr>hc6;iX"_;(]%T$SȢ$4NQ܊N Ӂy y U*V&/`$|wB)>LjG3JHPmŢnjN1@K.fv1Co`B9C4#'unBS҄<-Mgii|]+̒Y5GOmJ/{hxfSz$0-x2\WHлL"I"$7̯޻c˼#,)i]M0:ϥb@@f(DrAMLee.ɆojyaWdz;Ѵ2dz#?MÃ_7E!ԕ~@ QTGF8v߮-s۸ W @(Ҩ' ٫X 0%蝥Q,~/H.ߴܴAoWT3[mV.&;;;ɒ<=|g[O}g0`bILL1)iڔ LLˣC Bf?Й6eOI1I r$ݽJ}?y[y[E5yc0bI@T$-6cESK' ፇ1XDNVkp G8fJ/V$^=za1WL1W"3ksJIMo+.AUHKAQ* V70 rm.PffSCSrޡYd2l4?dmz/Z88 bp;9<֪c7 ?^wt_ƸiBZ^6XuXO7!cvI@Nbq"j!73п"d •9J;Ao.wbI0 WxQb<c>:rVm"R=@,PtϖhӆS0p3-؂uy#sCы;4,xEQt?vpD@"ٷ|C7a>_8`:6^D@>D::c.:]6{„i֢WXHHmiV5'Kr-zQ<ݠmQ@  !y" yOeMò~ϒC z[>#i҇y*أ9A |%cKP - 붆TsXY5MUSSe*DPIDBe԰u-+ iFۥ[7VM%>wίsy~N"K#b7s˓U cfDsטMW1_ypo [+;?I?9W.8_e2+^:IӂkK d|Xz@zTJ3j}XJiHA]?<0v+nMP8P!1T1`!Ei|:)L0wp+@1|ܥRVzɷb+E Vы"3E<l8%߾ۃsH:/-'i*S*R*R,4lT:zܥ0%;wû7<ԽC6=:^(% ؅}WzLajv nwYT& [b?22IH3?5ҒbQt jɦ&L7nZ#7acBA ,@FAu؈FdRj*Ȩ -Ӳוu*X*8eXe&,pE؋ ZyLt[[8'C9'rN4\pm8P5cZ ޚj_lyӵ2ҁ'yrs{wa1|ad h?b8Vu C_+55bpa45'fQ-NJgK%ܞ\7߶ Y.UE`weZh~|ʙ&WG][ :D֖--Aƨ"";Cq+(Np{7gY@=^j:׸=tvƘ5hAI_p4 |F3pjKyaSy MfdͲVc.VI6e^ERi.oD4n#!T.iyj WeDfq4fѺ8g'x-sñacD:FPC|[IYbxZhq{핛81*e߻7>]޾?-}*8–p T-Yrq 5yYXl^TlnxJ"-ߘEQ[ԋnDghs;q'⣕=vo}umgF`-Oc-C~Sl0WifNU HIy_R-+-S `mAWR>V}llUj3~^hBRЅʭX?t @bRxoCSwC(Ȃ So'N>K֋)s0Bj3Mg> x4 CHʼn9o7ݮ(IF@a'2MSC- TπxS&8&x%1eט\\zh`-ԍ:藳=058Ǘg[ " w]: gޠ0 EfA3^x[F*8 '+ת)Շ) 87=2R$C;޳ Ke/.\& 2^#Qp>`z%WbvYbN^:'0!x֍PHwi $7߫ʘ*5+^zKt xlvh0WMCsy䈉:N l"bk75c^EjXj5xrQ>HޚQS"r vys&I'5YǴع2y*LխI%81E8ku<G ّYE^<0S}?&lV5쎅_s+< +7s sy5 _v_BU"N2A%H=T7Ш1yD7wI;6s$yZ;h<g+,']nRN sW9-EMSud[Q..+D"2"ĈntÊ쬕sOΪ,>*RiIJCeHDŠ͖ ɱ"* *ÄA_#pb5UGyh[pW%h$ %AR|ia`vn4]I"XsˑH<]juʨ=F"x)EWt1c=3Eb~$x P#mc_: ZRRk94Bp>X.!(i)=/bcCNI!=WfƲfC^ ]6.Eo+x=Jc -;ۃX?~ױ=yxn%Wd~Ĝ>Ul6_[)~u>϶Ak3fΤIOgy2͡ר'Q97į} QxҖTgXxxߧ]zo>{N;NQc/96yVu2hEhTЮ#C< ?| I߮C2g8%*e`,ME`]݆1oacCyH㳓 { uzhڧͺa$k_S ˲|՘ aݗ}| r2ڰ=qXDb/BG8FA5U$6ؗCTwyXM2I˽g3dH̪½ (%1Yo-yOY(;9e [Q6_LՊbeQ(1+Y'ϗ=x?eȓ*ܧ2{tw Pm5`=U ?]{v3U ;c_i˜< ;ifn8NKb h+D}R<괠νӎrF#`"YGAc8\$JJ٭ Ze6DT\6;K9z 94`irq*x6Qu~8Vrهj~ if#vð<7鷇3'KW0DyiST|ZzcgYc?9h'w1ArDu>.mgژ:&jc/ Ǫy,6D@C\jggI#P{9S~k $C]{PP߆U<+'kث9+lWeW}'scلY>!uO v3+W"ǽsT**u?sJ _!.`{ 59o"5U D- l6s9uo6(}9ak 1OU:~pAe(|q"Dԏ 9h u71O{I{̺̏v ۘhrqGh;GlOY𔛂oB[UBcׇ'HgeG:I㌌Iүj'ϔ:q]5flۊ56^N)Ҥ)*3R5\cl$w^]iϒvDNVfBs ysŲy+r«F~74ѣZ,ᝰW? c2׎]Xp&aϏeaS2 xGTsFF;ϟU7 w-_nP1tCq`Մi./P #uǬc6k*cԏ ^9v]Wf7 'e:l\U^-x^Z ՟z8?G~@6ԓD<]ndcU1/KSw.Rt@#|~7j(l7'Koc9%zjwok}hx;eܣ.+g?zV}1e*wgi';g78 La/jx"!{!n? <ҶI/IF]7< ds 3cȝ WEqĉ'N8qĉ'N8qĉB| HA)f'S_2pu ]h$ڄHBM=Zk4]ᘱZk?Z'`٨u32h@u/%jɛ)SkmNsQ9 Z;SӵZ/u WD%Ʀ?uк5/: #2p$-Ek2I?K5Y)Jd]ZJd=7* K fԚdQ٧fZs}LڥNkmZs}sjyVk^?\Zs}s՚;t\ߢJ'\՚)Wi;yZIZW:E Z'slZ{NϠ?$]kK 7#7riI8% aڝVlp|!{ qؼb Vrb;nr834U_}U1&I'8&<)q`_qL_>cǿ"!Ib58&?yNvz1ƿ$?1]40$9/1aHD%D&)E0y|壖Hd1\F,RL$xS$u ?l㷑C`F3̙ϳ` PO;V33e˫]nm7H^eFB' :eDr9h 0-GdxG2 YTU=; լ .S/x#O&iUǾZB2 %*.nRL"қWv])ΤC"`9*K, Ə,9&"#pԜAY&#,ZB~XFOp,V^±<7f<Mv-G21wY"V6%A"!<8Јs5F)e)# mM )#&2> 5M's;^;0Kp~2Ռb\n!6NEXv .2zZ2 5P/T-J֌mX xnj`ьӬ ƵmW-.Wj,D 626U2~`wK56o셚Tq?]{W _WM%+6O]T =}?$Ki8J>x _O!݀d]$G ěqo-Y_twgl/E2UJxĞkSH{b_z?dL&67q{;E!$N)Lewzܱ,wMq|/uƍJ, Y TWŒoMX5+2Kzq.N8{BPSjP1+|)o\uqeY|ڙrMԩ7V6Ss ,GX[煬*%NV10eJ5w]c0u \:)'zB !qȩkP,Hf)# S\ʹq]k"1tF .e!s%HL(| U)'b G%4ȋP*)(U֐hfeb\[̶+B|&cXnW:`m>%rHwz(Վf*[)_Ki!Kg`#,/4Vb.y:1C~d&+荘Pu.ё._`*4>cLb xY1;4. `C3!DR3iWrLY)^}ߟis?-S_ʩOWR>Z|ˉsUypp8Nɡx1;8>?;ݿǵ sfR@kJhq+%;Ӕ+L`P_bZ.,3#{+83sP($/DRfyHiC3YRswg*h@LRJ ϕYQ5[Ɩ{% =ՑGu|<9t=*i pOAITU hZ]Q9^E*[l]njU3 8p5|C&4"1-,QS`2z=,NHF1uF ;T>yxSt}ݻC1[gOl߿wCZԏq&8\c'8D CHQͱ<9 ֒]!{Agp{;1CX0wa\SZʟ/,RLlCѡOnXs' 3s0a;rdK˖#Yv,3s )sm)3>vsb#Yڷ;;sgΌojgǩFw6RV =.NL zoO,q<=ھT|]^׾_̐VhGӀ҃MP8cl+_> ZC}.FE"+-L%}[wz_e|5m +Bj‚W)(s?|dձ8JND\(k#"yW GGƏ9T*>KRtWZnD_dL*=t=EvOTehjfp vz5ca@* \Q):ղXiRz_!j^$"$ bV(8?QDWo1A- ?X"#ߕy{qb2J񵈒v3ed]xBdmZuP5QT!Q u{8sp`9f&c:ĥv2&}1AH\U&5&5\eOm>pdhQ4dHF,iXRhmu9:hJThBq,wHDŽkJyR$e83D1XPrC'yrjV٣#:M (OI%yёN2IUN lI=/Wǫ>!]a_iL.KtY.LҿAd3ȴ퍕 ,PYTjUgB'[CT+Kԧrf>SRjNM䝨;5+^2rU&|^6_īsYS$LdZ>|Mggv 1` ];R3333֓K)jeoJQ~4R9kT0CkSZM%R}O'o_/zj?zTqvCU]HSHU F0VՃLU Hh2Mʢij򘡦lele\e9%)˖(k)YA+UZZGռQz| &!ET 0tBi [imvAt0Bat8AGQt4Cqt<@'It2Bit:Eg9Oyt>Ѕt]LХt]NWЕt]Mеnnѐ{>PyGQz'IzgYzEz^WUz^7Mzަw]z}HbO3/+o;~P'~_7?iM-m]=^BoA_C @ ` P C1#00c08L$LLEa:f`&1 1s19X\,b,R,rJjZzlF|@ Q 6!aa3"1T[P؆؁؅p08 p48p2N8 p6p."\Kp).W*\ko\ݸ܈p3n ܉p7{p/x!^|9 _|=~ ?;`z܀r#nM)7܂[r+nm-tw܉;sݸ;^ܛp_:qy!'s|/7˱{k~FlflVlvNn^~_~8?qoa#lba0B ؂ȓؚؒ'o=mؖ ɳx6<^,f KYro>M]x7-_ɗRo^˼ٹ;+؃bO^Mнx{U}ُy uxoMVjf1a-4xh2A6H)L8swá{yHhXxN|9a>Gd>)|S9OiN >g |/q&gq6eW98 u.b7m.2wc~O?_k~o++k빁?gn&nn6n.>/w!?<JR!V* Uj& jcԱ8BNP'TKJV'Sԩ4FUv:C]`Me[ ͩ3ZGwӎDI} V;KhQǶ"vF,fՎ^,ڵׅ5Cݣg=ejx"*S݇^Z4!Ӈ^"̄[>,DĪ}>8Le_T9竹YP3tFF#0$ x'THh_\w5\7f&㚊馫d0=)6Hƍi+؞>8jj RJ)]Ds{׸,K' q?ك,Une <jӎօ;̠Wf[UVcuYxU=gwa1tG'Y>5DM=bX^ WZT >@*mjWBJz5*k^%l+VHrE79{U/=/"KK)ױLL#Zat,.)]BUލw* Uw./8 vR]|,ytE-3G=Y>*.g=EGy=SeFA͑lGTUkt 3?q VYmIz7ٿ*$i|RIT{7Z%iKίD6tOPYN^KZ#f[ɿ2)x6Z^;sY|5^мԸůa>[$-/>wQWCw©x~3EΓz0ݖUq!i{O_uUPF/|uتFbe_{§&bTZZwzCFTli0U4 1?ݾyNg7M9ßǂvw?syK5u s[Ew?n/67"˸2Y"?wo[_Vlj'm/NU8݃9s8KRLpX.c/.vF$JR S pCh"E D,J%I'Y"Df 2+xhphphph3RH1#Ō32ʠ% Z2dΐ9C 3d6lPG98rp#:8K $NJR C5'\[?þsF%bL?fG:l&>L{n}4lnЍ9 j@gO]Vź@lmfD'ڢ_U]OZn=ҫy!\΍vgGjD>a?o~".0[SxFdw?|LYMكo6 %=B磴F_ʯ-Iգ] قK s>ɞϮ=9C*kj7uSTuF_ضmgWjJ2;Miv[NI ;E P IUR@(J2 S( T ~ONHYK QkIw-X/;dQ򻁽+\J-* ^e*܌BWI ߳SEgB%Мe@/3ebPQ\_Tעs9H0.\/%RQoҰfC1Q {73Q5 1~ ?x UH1Q"E P1`8Qow|:ˏh( r.kx>p7GE9Cq JsԆ]Z+CAدB (s+t)ߔw^=CGp~np0bK@3OsoCC30gH:"bǁC#|Xt=#(U͇2Xsë론OA*^6 ZqC=ŤW@_f?IP#,~~&&<ΗG8d2 0~‹pa$MV)9"TDFN)9"T䔊RS]! 02rJEN)9"T䔊RS*r J2x)9#2S:rJGN)9#tx VҀј)9#t䔎ґS:rJGN)(PNR@(J2      =EOm$"M;.ܱPCj=-]UWz4]lG=({`3ƶvUeYtG./VM>TvSWq`i={Nڃ+GX9Ž=N!(iHRK`Z'VpgմwyYl}ҲI&-dbVU%piHEY-݄|" o~7cqF.9ğwq.Vq.>_=6ۗ`R8)"ǝ.wCus4o.9&-:YpŽႥu c**gc8~'ymR yI&*jڑ3j1cu`JӰƤ6)t$U`HZֵjRBL]M2*-e{4Y9s=l߫r**~-w޻Un۱%vj}bgfk]sMeKe:.\6lre*5VZ.k]6lt]n˳ӝ2gWeK7ˍjrҥ^W~|o_ylpgZ΂VhR ZDyzU\)8f5(2 1Prb+ѦsTϜo;2N' bdH7!ӲF-O;EV$A Rݶ!?Sߓ=oRo%wQ[m! \ \$E'qd) <ɟ":,ίsQL+QO:dԁ"* Wݐ(&su Q"0ʟ ՐIV&1g,EFJjk%a_>2cc ʹ"7?a,X,Upb+c7q7jq*,?&qP» /ȧMᚦp5S)T1E0be/ t){%Nv1ߏ(zr|ŪLwf[|lp[#'z+g~g雍~.0qQ8O`54) w%VnCh l3CmNq o_ŵbZ/u9p6!7mnF78MV|o E$-:?<Le{MgN%06-ވ;j7e'n9R<۸˶H4 A\p i+'r21אV:t{; 8V@ P B9h* c T!: Au,X)ۅfv3M4M4O{ҳtI]deRf21_>A_DzwrK͵$'o%yicƛ)`cٴLB'c4V4klnct]<}UMVMWq;Yl5nGjJ7RO;i~{x<σe!?kț^^xgy;=>o;IfpC#}HngtGm6E`ʃ"`3Sl\/61v^G( FCQFt&J/DDP4eD3UN ]fN'A:nq:nq}=ڳa۴+Hc QΞGvأ$I5l+ԭ[BEam6<˲Y/B <j8-6H9$%Vպcr\;hO*{T{հ;cwCW;xw^r6O?ۇ}y!%Yv^,Y'(cgo)m_?l$b.b"Ek.oDQXWI _ٰR86 a*FB`[]hB_CCƛ!ㅐ%d4NoGӠ?YmXTggf0F%/fr_& e2T#.P&EtH+Åy< %͕"K?fTdj1L*JMR id$H%;fegWH ]nIlU4Q=)pBQWy^: B2Ob:sRsLV`ITzdz`lS\SSwa'+)FEbz1R3?$H֩$ u7V*:Ҍ#EL-d gLeN]`WieDiBbZ T(]J רt"RIΈiK~][vJq 8#n$?Y :#&zĥTXD]!2WVllD8b r%Iq2eSeʬ~ZD?2{b/%{E'U슩NldlO-z^n]ڪi-e!Ԧ,5c\ܾ煔˛? zY潺EK%K25(Ygp; ^{Ghm^6.'tNجkcǞkwc>јĊw mJ@z膴,bn>c:I+DWvh  -G$yf)+ қH0 y`z7IR&{7MCZhҺpBhL N]|ڈ$P0Ih%&z9%)N Z64H[5\6k6ЯxM/|Ka;NvH[4RR+i@D#}ہb-Rќ6|J gYkPaPQE0a-^!ծ1qI^9C;E|nH1kQ菊Boʷ܏~ Z[TM[P៓flr3ʵ{:lT+N3 PʧaSeAÌ݊}c aO,y Va E $\ endstream endobj 9 0 obj << /Descent -216 /StemV 136 /FontName /GDAIFF+TimesNewRoman,Bold /Ascent 891 /ItalicAngle 0 /Leading 149 /AvgWidth 427 /StemH 136 /FontBBox [-250 -216 1352 1000] /Type /FontDescriptor /CapHeight 891 /Flags 16418 /MissingWidth 333 /FontFile2 10 0 R /MaxWidth 1127 /XHeight 446 >> endobj 8 0 obj << /Encoding /WinAnsiEncoding /Widths [250 333 555 500 500 1000 833 278 333 333 500 570 250 333 250 278 500 500 500 500 500 500 500 500 500 500 333 333 570 570 570 500 930 722 667 722 722 667 611 778 778 389 500 778 667 944 722 778 611 778 722 556 667 722 722 1000 722 722 667 333 278 333 581 500 333 500 556 444 556 444 333 500 556 278 333 556 278 833 556 500 556 556 444 389 333 556 500 722 500 500 444 394 220 394 520 778 800 636 333 454 500 1000 500 500 500 1000 1003 333 1002 725 800 778 537 333 333 500 500 350 500 1000 778 1000 780 333 797 576 556 576 250 734 500 500 500 520 220 500 667 747 678 500 570 333 747 389 400 549 389 278 389 576 540 250 444 1005 432 500 333 556 389 278 722 661 667 636 688 667 989 528 778 778 725 745 944 778 778 778 611 722 667 734 859 722 778 734 1098 1098 765 982 661 678 1126 722 500 500 540 454 506 444 725 402 576 576 576 561 681 576 500 576 556 444 491 500 692 500 576 564 844 844 583 781 529 432 764 541] /Subtype /TrueType /Name /F0 /Type /Font /FirstChar 32 /LastChar 255 /FontDescriptor 9 0 R /BaseFont /GDAIFF+TimesNewRoman,Bold >> endobj 12 0 obj [/PDF /Text /ImageC] endobj 13 0 obj << /Subtype /Image /Name /im1 /Type /XObject /Width 316 /Height 400 /Length 379200 /BitsPerComponent 8 /ColorSpace /DeviceRGB >> stream $   !\ekmykttuuwwyy{{zzzzxy{~|~|{{xysumrfqci_i_j_m_j^k\iZiYd\bZdYf[i_mbqcobulsjoiojpjmjkhhfbj]fYbV_T]R\QZMW?KrT,:O):L%2@%0?$/=%0?&3?(4@&3?%0<&2:&09&09&09&09&2:(3;)4<"/0"/0"/0"/0"/0"/0"/0"/0$/2$/2%03%24%24%24%24%24*8;*7:*7:*8;,:<-:=.LT?MT2:E2:E2:E3LO>KN8IL7IK7IK7IK7JL7KM>LO>KN>KN>KN]:V+G+>G+>G,?H-AJ/CL2EN3FO*AT-DW2H[4J]4J]7L_:Na;Pb7T]6S\4QZ0OW0OW0OW1PY4QZ8JV7IT6IT4GR3EP2DO0CN0CN5GR5GR5GR7HS7IT7IT7IT8JT6IT6IT7IT7IT7IT8JV8JV8JV&EM&EM&EM&EM&DL&DL&DL&DL&CK&CK&CK&CK&CK&CK&CK&CK*HP*HP*HP*HP*HP*HP*HP*HP,KT+JS+JS+JS,KT-LT/MV/MW1QW0PW/OV/MT-LT-LT-LT-LT4GP4GP3FO3FO3FO2EN2EN2EN:JO7IM5GK4EJ4EJ3DI0BG.?E4CE4BD2AB/?@.>?-<<,:;,:;+59*48*48)36'04%/2",/!+/'&&%$"                                            "$''**4 6!9$= %? %B %B %D)7N)4H*/<mCjkdimjjmnnmpossqqrqqtdfjlprsswvwv~szsuoqpnpjphnflbh`i]h\i\g]f\g]ibpgsnwsyuvzszpxnxkygwbu^qXvTrPnKjGhEfBc?bG(?I/I[2L^6Pa7Qb7Qb7Qb8Rc:Te<]f:[d8Yb5V`5U_5U_5V`7Wa@,W%T`AS`BTaDSaDSa2JW2JW0IV0IV0IV/HT/HT/HT0GR/EO,BL+AK+AK+?J(N\>N\P]=R_=T`QZB*<@(:=&7;$59!36 25!/0!/0!/0!/0 ./ ,/+.*, " !                                                         $%''  % '!,".$/$/$G%/M,/Ef.aAHoB]\Z\^^_]^^^bcegfrqssvuts{|~}|}~}}vsrolggaf]d\g\h]qcsdqhtnxtwxvxqvpvpxl{kid]W~b}]xWsPlLiGeB`?^>[;Y9X7V4S/Nz(Hp%Cl6Ed1A`+QZE/E.?G*?R-CT.EW/FW.EW.EW/FW0GY'KR(MT*OV.SY.SY+PW(MT(LS0IR/HP/HP/HP/HP0IR1JS1JS1GP1GP/FO/EN.DM,CL,BK+AJ2CM0BL0BL0BL0AK/?J/?J/?J)GM)GM'EL'DK&CJ&CI&CI$AH"DJ"DJ"DJ"DJ"DJ"DJ"DJ"DJ'JP'JP'JP'JP'JP'JP'JP'JP*NT)QW,TZ*Y](^`%`a aaaa eb%ec(cb,aa/]_/Y[/VY.SWG1[:Y:X:Y8V1Q|-Lv+Ig(Ec&?Z$:T$7M&6I%4E$3A3?3?2; /:2:!29$4;(5<&7B%6A$5@$5@%6A'8D):E*L'>L!@H$CJ&DL)EN)GO-GP+FO+FO EP"GS$IT&IV&IV&IV&JW'LY)O[+S^)Wa%[a"]b`accfd_g`i$aj,ai2bh5`e3Z_-TZ0TY.SW0RV0RV4RW2QV/MS0KP=MV=KS;GO;DM8DL4BJ-?G'?E.DN(AJG!6@':@%8?$4; 04./+. //!//'*$& "                                            $%'+//"6%9'? *;%*6RmkJnQf``adbbcdkghkliiprllqtusvwtuy||y}p|pvoqojofodofofspuqxvz}||xtmjjhifcad_|ZtUpUnShLbG]C`A]E>A"]<\>^;\7W1R~0Np,Jj(Db'?[&G(AJ*CL+DM+DM*CL*CL,EN.GP.DP.DP,CO,CO,CO,CO.DP.DP*BN+DP-ER-ER+DP+DP-ER.GT/HR.GP.GP-FO,EN,EN+DM+DM+AK+?J+?J)?I)?I+?J+?J+AK,EM,EN+DM+CO+CO*CR*CR*BP'BM)CN*DO*EP*FR*FR*EP*EP$GT'KW*P\+S^)S^(R]$S]&T^Zc_hhnsx!&.&/(vpws"vs"qm)jm(fj(af)^d-]d1]d3[c4Wa)Y^&U[$QW$QW!VZ\_ccgeol wt&|%&%{qnebNRIKBE?B">B%8<"/4)+*/%* "                                                         !"&'+/!3$5&=):$)5VqmOrThdceddbacmhhmljjnqkjpssqsxtv|~|{}vu|uxvtururvttu}v|x|}|{wrmqmmlmie_hb\|ZyYvWsPlJgHfDb@_?^?^<^8Y3T1Rt+Ln(Ef&B^'>W(G*GH(>H+?J,BL,CM(?L*BN+DP+DP+CO+CO+DP.FS.GP.GP-FO-FO,EN,EN+DM+DM+?J+?J)?I)?I)?I)?I+?J+?J*EL*DM*DM*DO*DO)ES)ES)ES*FT,GT,GT)HV)HV+IW(JW(JW&MY'Q\&T^%W` X`Y`\b^d jnrw &/B%8?!29/5+/$) !                                               "%&',!/$5%<'9"'4RmiJnPfb`acdba_kffhkjklkgilqonrvssy|xxywvw{vwxvvwwzv||zz{ywwsmjonmmkib_d`]~Y{XyTuQoKjHiCd?`=^=^<^8Z3W1Tx/Pr*Hj(Db(A\'>W'QZ %*J(?K*AM*AM*AM*AM+CO-ER,EN,EN,EN,EN,EN+DM+DM+DM+AK+?J+?J)?I)?I+?J+?J+AK&CJ&CK'CL&CN'DO(DS(DS(DS)HV)HV+IW(JW'KW&MY&MY%OZOYR[W^\a`eikqsvw/AJûPPVFK8ʸ  +7D6;5:/4*/"&                                                $%&) /$2$;&8!&3OjhGkNd`bacbbaagfgijgjmjfelmnmourrwxwvxtuv|wywyv|xuzyvvvtnknmmkkeb]c^VV|WySvOpIkHkBfG"5=,>I-?J-?J,>I*J(?K'>J(?K*AM+CO+DM*CL*CL*CL*CL*CL*CL*CL,BL+AK+AK+?J+?J+AK+AK,BL&CI&CK&CK&CN'DO(DS(ET)GT(JY&JY%JY$LZ!N[!Q] T_V`W\\`fgpo{y*7MʿajrrsdU:Ҽн$3' ;&ĴAZfe\UJROCCE7Ϻ zwomdeSVHK>D:=24*.%'!"                                              $$' +"/":&8!&3QkiImPeaabaeedcidgjmikniffkolnqtpqvzwvvyzz|z{{{{zxwxwspppmmifa^c_ZWW}TzPtKoKoEi?d>b?c>c9`6]:^6X/Qu.Km+Hf-Eb,C]+A[)?R'I*B7933//++')&&%%""                                                $% +!.!9%6 %2SnlLoSgbbcdeigglgimlkiokefjqmoprpovzyvw~|zzy|{vtrqnkkhb`ed^[[X~SzPtMqIlAg@dAf?fP&:L%5H!3B!/@ /<"/</9 /: 2<"4?$5@$5@"4?!3="5=!4< 3; 3;!4<%7@':B)eZgbcgijigf=:crTFH\ypfegچ]h~tdmbq|zsdztzst^ހvvop犑jmzRvUwIX>v{Cg|WQcS`BRTeCW4RSr/P?\,^2b$Or?_+Ii)De&=^/Gh%CP+FW3E[-4O ,*3E' +/6 %%/5 ,3*N(D CL-HZ":H,>I):D2EL/FO7@CRSQ_U>%6<θ mo im`fZ_Z_V[RWNROSNWJTEL>B7;69:<=@ 495:/5$                                  "&+,.%8)6"'2 ]igAgZh`bdgfgcdў^逊y盶}V[cHsyB~[o)RYOu8f8c"Jo0Tu/Mo8Tq+Hf1If ?O&?R/'9@J\1J $,6!,*4.?J.8(7A&g̱3Yf;a>f.R|+Qv/Pr;Xu+Gb,F_)B]!6EVczm}4/:/8'//:DT_JZe&6A):E/?K /9(8B&H"% '+AM"+ &5:*/&CN,\Qdx&(:M >"8E/6%!(:D 5A L^hZkv%/ 2< 2<*B %+!                           "'. / 0%8)6"'2^quMlaoedffcdbdmq\~fuwW|dgL^vUgGcRnxW|c|_~mN~vd~>LĒE~dI`)J;jVAn?`Rl6T<^/W*T|4Xy-Lg3Kd"/K}w&)/9)?.?\'H/T\VY48L:VDp٢o~sfUN{vtmojT@0(̷Ʋƴ²ij FqtaK/н "vvPT8=")                        !$'. / 0%8)6"'2\noHh[lab^bbba`^\LlDDf|af^w㈪e|gscgokykQ|ZPjWZ9}\EM{梲SvP:zLzFeE`9\,W,V2X~.Ll'?\GQ` '+DP"6H(8L.A2=-?I ,3'/EXa)4(d<{9~>o1MJc;^6b)X*S~1Ms'=as!<3L2G*?N.5Mcn^rz)40:(>H+AK!6@.6"7A%:E2;!2;4B/? )9&)(8B *"7D3? 'AMP y&/.OY7<%*+3Yjn8A;H"UdUYi? ȲiǼܝfx|jp^bisx||u|rf]WNIм ̸λ8O[`eQLGLbylQ sl^\STHL7</3 "'                    $%),..%8)6"'2aqpCeYm^abbccgglG^tRsuor\wRcgegNTz_k~mxhnjAd]7坷Eof0rH`KqG;OB^8Su<_Ep*](Q:Y:Qws!C.Fg";T+AM,,%)0 $6?*53<(>H/93<,CM%:E&/!6@$4=5D/? %5&/3 .6!3=4@3? %*69|/<$lu~JVZ $",>H4926i{ !s$6:AL!Tb4hzZU+Ȅ+e߸mJP^ms{zlaVVZT$=:ѿô"˽Chuv}pfUA9L`qx;" ²yskmag/X]&LR:<&'                !!%&'+,,%8)6"'2hjo[y^icfca^_behd%`vXW[cfhkUTivN^j]vth`bfe]uQ2RVmon[[l?w74?vTHu?n?j?h7a3[4\%<$?Z0Me'?W":N*6J7DV ,+6?$29/8"Z(Ea6S1If>Y&?W$8K*9(7B,>I$./6/;/;/;/;/; /< /< /<"3</= $3 +;-AJ,4 fwZgpP\fdq{$/4 +.:,GT6ITOem EXaRemScl0@'BMH]f2EN'?ɿەݤ||Bhܻ$"1-4C/fx~zrmLQZcghcc_`TDHQJ=vp]_ NW$GT;9 !               "%) ,!."/%8)6"'2jinZw\g_dehddddTfj/YRfw5Ni)@]>Us/Gf4T(Mk8T":R,=  +G)0 )!,  ",&/'3 *'N&>N5E.+FW8G3R_"CL&EM$HR"S_%^kQ`(Wf:"T|ӵz|9O7|Kʷѽ &ͼʸD݁v~{z{nkdVIALSUNDC6µ| faDD 2/ "              $& * ."/$/%8)6"'2dgjUsU`X[[^[_be^exU^]Z^]^efnnhW]_n~bjlhb[fmreeifs_ne__j^Z]eu}yoz߄]\gCGo_VSMFyBtDsDtCp>k0a6b"An?Z|pQk`mzIUa %:L_ 6+8+8+8+8+8*6*6*6+1>OM^o>GSFKS):L /<):H"8E%,82="/5A)6,CO,8&2/;!6B+BN":H%5I,?S 3!6I%>O )Ķ!.>Uyp{wvvusf_S>=LKEFNOA4/.Ҿwna_HJ$)              %& + ."/$/%8)6"'2jilXuXcY]\^\`dgtjjkfwmgpaWsqrdstqwjqpsiurnUfn{lpha[gYhg]lg]Z^cpb\[VV_oQXQDvDwRO{?m;q:hDfA[&V /</;/;.:.:,9,9,9+@J\ƿT`r' .%22=3? ".:D+4,:&4"8E+5$5@$:E,:3A%6J!0E*AT)?S"K >M ?O!@R CTGP?L @T1Nf/VmXliuQă؟ް޼jT6%ElV$ƽʾ( ȿ Tߓ~ys~mkyrq{kxm_hyve^FSgrxz~~t;ƭ &pk'M >M ?OAR CTIT"FV&J^*Ne Rh\ku}9e͐ߥvpT3 :F/Ĵ ƺĹ  G֍~|wzhepz~{ssxwu~pO[fnw|j' RW8;                 $% *!,".$/%8)6"'2nzqMjSfeda`_`abdbcfd`afcb`ecbbfhefkkhfgnljjjlljmkihkhdb`adjnnooqnqopnihcd_]_ba]VUQLLM~KzEtCp>kkT!:P6J3H2E2E2D$7G"6E!5E3B2A2A2A2A+:.</=/=.<.</=0@/;0<2=3A2B3D7H:K:JPAS"EZ$I]2Ja'RfZjhs5_uۜܥ|bG09id> ˽$ƼʹXٟz|~dmS?iWI_~~`wy{0|sKK23 !                 $& +$/&0'2%8)6"'2p|tSs^pihca___ababdb^`dXU[_c`^dc`agkfdemkiijkjijheffdfbbcilppsstqmkmkhdfgecdhe]VWUONNME{BtCr=n>kN>N>P@RCW!I\$Mb.RjTiap&VzԏޤqbUM/$Rۂ0ƹ 'Ƚ ²ѽbߡyadpoT0@ 2\eHgjo{fBxpTS78 !             !% '!,$/&0&0%8)6"'2p|vVtatfca^]]^^^[\`[VW\NOU`fc^bdabhhecfkjiijkkjiicfffgdbfhnosrurqmijgfdfhdcdgcXTSRKLNMG{Cv>rN?O@SASAV EY$La&Qe+XoYmo|JqѓܩrcDPVC&0I˺ѿ û  źϻ,omA.cnQ&й*%FMUg~h:Z[69 !            !"& '!,$/%/%/%8)6"'2sy[yfxhgebaccd_]]_[UU[LMXdgcaddcdkjhfiolkkopppkgfdhifgfglrtvuutsollihfhhfbdhcZTTSLMOLJ}OI{Bt>o>k>j>iW"ٽNcA/ʵ®Ѽ4Tp["xxGM'0           "$ ' )!,".$/%/%8)6"'2noemdccdbejmecdec^_dZZ]dhdccia`cddbgrmklniginmhc`_aclkklorrpwuoljg_Zccddcb]\[ZUTQPNN}M{O}LzDs@q@q?pV!:S 9R 7P 6M 3I 0G /D /D2D3E 4E!5G"6H"6H"6H"6H3E6H :M:N:PV@W=R!?W$C[$C]$E_!Me TkYnTs mM~՟߳|ncVD пƺƻ.! ȼ!/İ־Hۢ~~W( ӽѻ վлʹ˾< =`^dxAҼ c_?E/3       $$&'!*"+&.&.%5)4")/nndofhefcgincaceb\\cWX[be`]bc]]bfedflgeiifdfnjieca`biiimprpnvqmiig`Za`bbba]YZXUSQNNK}M{O}LzEtCrDsCr>o?i>i:f:c7^3[3W0V~*Mr'Km%Dg"Cb$A_$?[!Z!V$?W%BZ$B\"A[ A] C^$Eb"Ha%Ic(Nh*Tn%UpWp_yi&VʉqU3?<ʻ̽ƶ!!¶cWҼJN1 %&ν;΂xItp``BE&'     $$&'!*"+&.&.%5)4")/yyowuuuqljkljgghf__da^^ad^\_a]\fhd`_d__fidghdfeccbaafgiorqmkpjfhhjdb^\]\__\]`ZXVUUSQK~NKG{EyI}G|DyGvEtDqAo>i9e8a4_:]6Y0T-Px)Ls)Jo'Hk(Eh$Aa$?`$?]!<[$;W!:T"8T!7S"8R"8R!7P!7P"8R$:T&;T&k]&>[&=Z%[)A^*B_'Db&Gd'Ji(Mk)Mn(Po+Ss.Uu)Wu&Us'Zx,bbew*Mȁsu{oL"/445=DLI>˼%   Nއ}[7ǹ пտȼ,(*İѾ7Ǹ ƷEVNem.Ͻ|ffKP45 !&      $$&'!*"+&.&.%5)4")/vxmy{}{uoiffheeeb\Z_ga```WW[URSW[Z\ab\]eihhldb`_`adi^][^bdcc`[Z_bda\^\YXXXWW]\XWVVUUPRNIGHID}CvAuAtCrAo>m>i\!>\!>\%A_'Ca(Ec&Gd'Ji*Ml+Pp,Qq-Tt/Ww0Zz.[z+Xw+]|.d f i"~25^ҋuafqjJ%==?>KWWTE'!ö  "lgL:/'ʽ־ ɽ0°|Dѿ6h~J1 wv _a@E +, $&    $$&'!*"+&.&.%5)4")/{|r|zslkjehihecbckgfhgbae\WY\^WY^aYVZ^^^`_^]_adbafffhjjgd^]^cfhecab```^^][_ZUTVSRMOLIJNOL|GxFyJxHwGtDo?kj?c?b;_:\8Y6X7U7U5P~3Mz0Kx/It,Gr)Fn(Em(Ek+Bi,Cj,Cj)Bi)Bi(Ek(In-Mr)Ps)Tx,W|.Y.Z,[/^/`8b.i&j1m>n.r I{۫}spuxjosoi^B   0]|cP7νʷ% ʷ²-"κAvnfusd- ͽ lpFN)0%. %% & '"*$+%,%,%/'2!',{{qz|vpihgcegec``bgddffbbf]WZ\]WX\[VTZ^__a_\]^`ba`b``bb`]ZZY\]`_`^][WVUXYW[[XTUWUPOPRMQSSK~K|K|M{KyIuHrCnAlBg@d=a=^:[8Y9X8W8R7Q5P~3M|0Kx/It/It-Hs.Dn.Dn,Fo,Fo)Fn(Hp+Ks/Nv+Qx*T|/X0\2\/^/_1a3a0i+l/l3p%w4\ևx|iO7) ȼ  TT:4 ʹ ˻ƳİƱ Ĵƶ  п!ƹ[>[>X=Wi?n(o?tDr0y 4nl]h}fG0|U$ɿľ ƺȺʹhZ˺˽õ$CZhGƵ (J Ȼ¶ ͽڍS"!"ʼnnCG',&) !  %% & '"*$+%,%,%/'2!',w|{ytoihgcehhedeggcbdc^\b_Z\^]UWYYUU\`]ZZ_^]]__^\YXY\]][XZ\YYWXSP\\\`cddcTWTTTZYTVYUOOSSOTRR~O{MwMuJsJsIkHjDgDdCa@_?\?\C[AZ>X=WX>X=W=Wd\=[<\AZ?Y?Y?Y>X>X=W=W7V:X:[<\:\7\8\:^@aAb>c>d:h;j=qBu/zAvH}5 oaG+ Ķ /.w5žCI)ɿ AUuxI|wHJ$56)* !$ &)  ! "!%"&%)%)&0)3").v|nqppnmmpd``egdgkiffhgb`baYY[^XY[c_[\[_]^a_]\[[WT]]]^`_\Y][\^ac^Z`]ZZZ\ZY[WUUYYWTUWVTRWXSUTV~SzTtUpTlVjOkLhIdDaA^>\<\<[?\?\?\?\?[?[?[?[;Y>[?^?^>^:^bAc?c?fw>w8!7؆q{[D74   :/ )GpJ пʸ)-=տDz1Edx/|sxw|s̼ Ŷ.j~uR<4 fc%GH/0"& ''  ! "!%"&%)%)&0)3").{|r{noppmlmnc__dedgkkgfihb_baYY\^XY[b_[\\_]]a_]]]\ZW]\Z\\]YU\\Z_da\V_][[\\[Z\YVYYZVSUZZUVYYWWWV|VyWtToSkPiOlMjIfFcC`@_@_@_C_C_C_C_C_C_B^B^@]C_B`CaAa>bBfDhCgDhEjAk>n

tBxHw>|) W{rTLMʼ/. '=Iޒ|{~qaSBʹϿ&  ƺO/ 7ķ8ʿ~' ƴKނylhh0}ZW56"& )%  ! "!%"&%)%)&0)3").y{ryopqpmkmoc__dedgkkggihb`caZ\``[[[c`]^^a^^ba__aa`^gbcbcb`[`]^^dc]Wa^\\^^^\^[\ZZ\YW[]][Z^\YYX~Y{WxWsTnPjNhMjLiIeEbDaC`CaCaDaDaDaEbEbEbEbEbC_EaDcEdDdBfGiJlHlIoGoFrDsAuBwB{Ix77qfO:XEý0!/2.@@CA30 ,.@IPczxcL ȴ ϼ°ͼ³  6 ˹\uVC˷^ߟobm]4vs>B%, '  ! "!%"&%)%)&0)3").rsirijkkhghjb^^bc`begccfd]\^^WZ^`ZXX_]\^^`]\ca__``^]]\[^```afdccc`ZR]ZXXZ\\Z^Z\YZ\\Z^aa^]b^Za|`{^zZwWsSmKgHdFcFcEaD`EaFbIdJeDcEdEdEdGeGeHfHfHcIdIeIeHfGiLoPrNqMsNvKxGxEyB{D~0! Euqjky|_)1.JMC1ȼ !( *BVhxOI Įκȶȵ}|пRG[C 5J 'ʀjsOZzygC{CJ'2$)  ! "!%"&%)%)&0)3").onepfghgecefb]^_`]^cdb`c`[Y\\VY\_XWV]\[]\_[Zca_^^]ZX]ZX]bdfffcbbb_ZOWUSSUVVU\ZZX[Z[X[`_^]`^Y`z`{^z\vWrRlKgHdIdHcHcHcIdJgMjOkEdEdEdGeGeHfHfIgIdJdIeIeHfHjNpQrJrMsNvMxGyAyB{A}"'T݃~obZ_kmL?GEG ƾο': KԢlVTsyl]qJEM +5 &+   ! "!%"&%)%)&0)3").f|\wkulmmkgefgkiiiebdkgcdig`^`c^^a`ZX[XVT\\YUU[ZV\^bc`lhdcbb_]cbdcedb^b`[[ZZTS__\ZZ_b^feb``hfbg~c{`x]u[tVpRjLfQgOfOfQgQgRhThUiEdHfIhIhIhIiLkOnQjQjNjMiIiJlOpStQsLsMwO~JC~A}E/]ۅn!5O[_l~|xojK$ (NJ%oxyw )4Ͻ0ƽɽ ɮ3M\r{hQ_nkeXCST/4 " !  ! " " $!%!%$/".$)ezYthvjkjhebcdjgiifbcjb`adc^[^a]\`^XUX\ZX``[XY[[[\^a`bheb_a_^\fdbbedb^b^[ZXXTP[^]\]abZ`bbbcid`c{by^v\tZsUoRjLfOfOfOfOfQfQgRhThKjLkOmOmMlOmQoSqPiPiMiLhIiJlOpStQvNvP{QKDEE$+FnDWinks|zvxaRG<*7!7sukdX>),AE. 3ξ ^J IJTrtkU]fgf^HŵWW26!$!"  ! " " $!%!%$/".$)bz}Ytdslmljgcddfddga^_fb`aed]\]`\[^]WTWYVU\\YUU_[[Z]`a`da^]^^]Zcbabbb`]_^ZZXWSQZ\^^`baZ\_abdib\{_y\vZtYsWsToRlMiMgMgMfMfMgNhOiPjMkPmQnQnPmPmRoTqMgNhLiLiKiKmPqTuRwOvP{QND~?A&7Qwmx|s{ztnllotxnX= %)9\sUXpXT,XljjLCHTP>)%/=J5Ĵ { ·ǻƺѼL/4gڡwdbhffdE ȸ ]]6;$&"$  ! " " $!%!%$/".$)d{Xseullljebbc`_`b]YY`b_`fd_\_`\\^^WUXYXU\\XTT^^]\^__^db^^``^]cbbcbb\Z_\ZZ\YWVZ^]^`bc[\^``bgb]|^x[vYsXsXsVqTnPkNgNgNgNgNhPjRkSlLjNlQnQnPmNlPmQnNhOiOkOkNlNoSsUvOvOvP{RJ~?~7;7\؁wks|rg]Y`do|YSE(&"TQDCH^C`umYF9SQTXVOLI]JE7̻zv ͽ(JA\߆|oqunehEʹdb:?%&"$  ! " " $!%!%$/".$)e{]vgunoomgdde`]`c]YX_ebchhcaca]]a_ZWZc][bb]YZ`]Z[_a`]fdbbccbadccba_\X`^]\^\ZW]_\[\bf`__^]^db`\xZwYvYvXuWtTqRoOkOkOkOkPlRmRnToMkPmRoRoPmNlNlNlPjRkRlSmQnPqStVwNyQyT|UK>78AjސvbXfpbUYaa`\   :,lz~{yj\mwW=0)\`bbdimjbJ<+%7(tn ȺȺĵ(7= Lv|kmzkh? ʸ lg<@&&!"  ! " " $!%!%$/".$)h`zkxsssojgghb`dea\Z`fcdiidadc^^a`ZX[a\Za`[VX`]\]^```fdbaab`^edb`a^ZVa^]]^_^\^_\Z\bgbbb^\\db`ZzXxVvVvVvUvRsOpPmPmNlPmQoRpSqTrRoTqUsUsTqRoQnQnRjSkTnTnQnOoRrTtPySzV}XN?48DqoSAVxyqxe[S^cQ6$  " ErrhWF"Cb+'*".NuPH< ԼEb̻R_ʷ˺%dzɱֽ ;byd7˷voDG))%&  ! " " $!%!%$/".$)i}]xlvopokfcaaYY]a]WTYa^aeea_b`\\^^WTX^ZV]\VSS\[\]abbagd`^^][Zgcb^_\XS[XW\\^]ZX\^_bff^bddcbf_WwXxWwUuTtTuSsOpKmNlNlNlNlOnQoRpSqTqWtYvYvUsSpQnQnPiRjRlRlMkJkKlLmDpHrRuPwFy7}*)K{tj2Avvn_ZextfQ<%$  .]t~pxsKվսI|R>% :j|G( ƻ)ŻE'ùĵĹ>Jͺ$Hҿʮ4dzd.˷zsGI++')  ! " " $!%!%$/".$)zmjgzrjjgfdcb`d`^ba`\b[Z]bb]Z[ZUUZZUUZVUUXZZVQXWUW[][W\ZY]`ccb\\]]^]]\RQQSVVTRW[^[\`ff`cea`a_\}U{W}U{RxRxSyNuHoIhPmRpOmOmTqWtWsTwVxWyWzVySvOsNrKmLnLnKmJlHlKnNpHnCpCuIzFy4| Zڐp&VbJoj]ZkyD& .   Ļ ƽ¹   4Ofw|q~ug`fkbZT,""® ҾJڄvwY)4QH% HOV %Ʒйî± ˽4ŮgMCυuKDö ON )% .)"% "   "!$!$ ")*&&"&|pmi}tonljjgfdd``ba^\`ZWZ__ZWZZUUZZUUZUUUXZ\UT\XWX]``[a^\]abdd]^____^^XWWZ\]\ZZ`_\]`ffcfgccda_W}YX~TzTzU{RxKrKmPqSsNqOpTuWwWwTvTvTwTwTwRuNrLpJlKmLnKnHlHjIkJlEj?nBtGxDw1~ %ig+Xnx^/MXsns~\+$      ):UsgWQR[WSS   ν̼ȷ˵-rsk^jZ(տӽϸ)ͻ3:B$̼ ɼ:ѷѽ˻ƶO%:o{fLfC`]/, +*!$ !   ! " ! ')&&!%{mkj|skkjgedcbd`\``[\aXVX^^XVXYVVYYVVYRUUXYZWSXVVW]\^Z_]\]^cbc[[\\\\[[XWWZ]^]Z^b^\^`dadfhccdc`W}YW}TzTzV|SyLsLnSsStQrQrUvXxWxRuRuTvTvSuOsMqLpHlJmKnJlGiDgDhDhBgj>rAt7r-*0SԃI >u~! "-!   ļ&Gבrg\D(ѿν̻ʹοĶ´̿56ƵUwߗ?® lg/;      "j``]sb`ccb\ZYYVWX[\]^^^ZZ]\YY\_ZUWTQPUVVRTTWWXIHJJPQNKOOQVYWSNQQRRQPNNU\ZZY\^[WSQT[`^\\\VQ~P{U~S}PwJtKuKuLvLvMwNvOwNvS{T|S{T|WXU}WzWzWzWzWzWzWzWzUsTqTqRpPnMkKjJi?kGhGe4i{ 6]؈|u`7  '%43*!,&! %% 0ľſ    "BJmQ /bve Rи θ̱/S49GDhT7  ͼLdyV̿"}y49     " "j`d]sbhiigb]]]XY[\]]]]^[[]\YW[_YXYVTRXXXUWVWZ[NLMMTURPRPTWXVTOQRRRRRQPUZ\XY[\\]ZVY```\ZXUQ~P{T}R|LvJtJtKuKuLvMwOwPyPyU}V~U}V~YYV~X{X{X{X{X{X{X{X{VvVvTuSsPrLoKnIkAlIjGh6nBfܐp\?  $$"/2)" "+"   7"!  ʺ-A0/NPN{\lEjDi4p Ilݕzx|gA !) ),!--$"& .( /      0RL.,C Ӿ!UqlgaIm^`{5 :^`TzXEKG{}?dXQkc+AG  " "fZ_YoZbded`^^_ZZZZZXVU\WVXWQPU`ZXZYWW]QQNMONPQLKLLSUQNRNQTVUSKKKLMMMMLQWYTSWWUfb_^`_]\PRRM~L|Q}MxFrIsIsJtKuLvPyR{T}PwS{T|RzRzU}T|PySzSzSzSzSzSzSzSzTwTwTvRtNrJnFkCii/r%QrސbHA1 $)'%.0) )1*%)-," !   ¾     0NP?4M]Z-Ѽ'LCޏwdr'cڠ~]TE1ͼ rnojxxsųDV>A\fbݦg-EJ  " "j[^\q]]_bb`_`a^^^^\ZYW[XWYYTSW]XVZXWW]PPMOLNMOLKLLSUQNILNQSRMJLMOOOOMMJPTPQSQOb_]\^^[\TTROM~N~NyFrJtJtJtJtLvPyS|U~PyU}U}RzRzT|T|PwTzTzTzTzTzTzTzTzVyVxTwRuNqJnEjAh7h%̼{vtm * IYpcZmk0OP  " "kZ}_^r[cffec```\]\\ZWWUZWWZ\XX\TPPTRRTYUUPPOPLMNLMMTURP?EJNQQMJTTTSRNMLAJPNPTSSXW[XY\\`b_YRNRNIyNyMwKuJtKuNyR{T}X[[WV~XWS{QyQyQyQyQyQyQyQyS{U{SyPwKrGn?iEY_WEKHHJOOPMRLE>=???>KJDD<2>OOOQSQKGUTQPTZ]YQSTPQUTO{LyLyKxLyLyO{O|Q~SSTTSP{MxKvOvPwPwNvLsLsMuOvNvPwPwMuFn>h7c7b9i>b?h1*j֗F/(2%!!')-3:5-(+)((  $&&($&x ~~ypvnpps tx|~z}v{ tzov krfmcjml}|ı   '":: UjqtIKl_L~w|x|y ¶/=EUg{JOR)&$"!"  "fQ{\Ym]fedcb```]^^\YZWWZWWXTSQVVTQSRLIP`PAIZ`UCNPKLRSTPVPHABEIKPUMHPLDJPPPSTSOJVWUQW]`^UX\XY[WQ}M{M{LyLyM{O{O|Q~TUUUTQ}O{MxNvOvOvNvLsJsMuOvNvPwQyNvGo@j;g:f/f:_=d/,mڙ23$. %7/ *&!%*-/3:7/..1..$$!  %)!!{ |tzosqtsx|}y{ tx pt nr lp jnim|{  =LCSbhs@52'>? ˹ ĸȼ ~|̸)FSivMLP*'%$ !"  "dP|]\m]bccb`^\Z[\Z\ZWWYZUWWURTXWUSXWPKP_N:?U[K2QNMLRPPNWQHCEKOPXXLGUUOSKKKNQQNJUTTOT]][W\\]\[TL|L{L{L{JzL{L{L|N}R~TTTR~P{NyMxNvOvOvNvLsJsMuNvNvOvPwNvIpBl>j>i/f8`:f0*hܕN /8*&!%%!!'-+/251-/13.,(($!$ $& !}z}~} yx y||}|vpv ko jn lprw pt lq jo jo mqqssvsqus| &- н*;? :Ÿ{y{y~ Į/Tcu|KIM+)&%   "$!! "bKx]Xk]___^\ZWVUVWWYXUWURSTRQPVVTSXWPJN_K6?RT?&OLJOOOLISNHDEGIJTVMKVVQVBBBDGIFCLNMKOWVTWZ[Y[YTL{O~N}L|L|L{L|L|N}NyO{O{O{O{MxKwKvLvMwMwLvJtIsKuLvLsMuNvMuIpDm?k?l5j>d?j3^ٍU%*A5$ /B! "(**',(((*-/('*)&"!!!$&$" !!!"" {}  | z{}y usttsq o| n| n|ktnxqz qz nt im fjcibg`gbhbhfj knrsxxsqzw * ȸƸ!$ô п ȵ |{yx ȵDesECI.+'&!!     $%"" $dFw[Ul\^]ZXWVVVWWUVUWVVSOPSQPPWVUTYXQKNcO>GXXJ:SPMMOJHERPKIHGECANNJRLGR?>>AEGEAJMJKPSTNX[WRTVSMONMK~K}K}K~K~LyM{M{M{M{LyLyLyKxLyLyJwHuHuIvKxJrJsLsJrFnBl?k?l8m?gAn1Uچ|B"!"' 4%$&+/'(+*('(//-+.+(%$%&''%%!"""! }xy}!~}|wvvvtrn|n|o~o~o~ m| iwftdp ju qzt~rz lqdj_fW^Za\d^e^ebghkmnrqzx)!* ʼx̽*&74 soxwvt~ %^C{CI/.*)$$     %&$$!%eHw^Vj\`^\[YY[\WWWTVUUTSOPTRSTZYVUYXQMR]MCNYWPNVTPPMMIHWTPMLKHE?OROSLITIHFHJJJHMRPOTVWOZZWSSUVNQPOMK~K~K~K~O|O|O|O|O|O|Q~Q~LyM{M{LyJwIvKxM{JrJsJsIpEmAk?k?l7kQ+ (&|y~ ^{|8ϽzsEL0/,+%% "! ! ! %&$$!%cGx]RgZ[[\\\\[YXXWXTUSTPMNRQRRXYURUTNKQUEDT\VW[ZXSPMLKD\VOKKMOO>IDBJGBKRPNNPQPNSUURT\ZQTXYTVXTNPNLKIHHHO|O|O|O|O|Q~RSL{L|L|JzHxHxIyL{LsMuLsJrEmAkAl@m:o>jAr- Lz^4 ,"QM%/ *4.+/-,(3>54-//4242/+'''+-'&%&'*(}%y||yxvss"uusrqponn~ p~ ly jw mzrt p~ lycpfrhrisgpdk^fZbZ`\b]cZ`U\V[\`ce pqyy%$ö  |~y} zv~4J8!ʹ:Ǹ /  ĮD{up}(ųpiCK30.,&& " " " !!!&'%%"&`CuZL`TUW]``^ZWXXZXTTRRLIKNMMNTVQLOMIGNUKM\c_`gUTOMKIDB]UKCEMSUHI=:IKCIUSOOPPOMTTVQV\XTMSWVXXRKQPNKJIHHM{M{M{M{O{O|Q~RL|N}N}L{IyIyJzL|NvNvNvJsFnBlAmAnBuDoEt0 As~B(ȸ03-! $&!%*$'(&)3>74*+,/1/41*((~),.-%%%+,&y t{{y!y us q$s nmlllj|izjy p~ jwdr hu n|sq n|eqcpcmdnenfmeldk\a\b\bW^T[W^bfkn no!  м~geedxw {{|wʺCȴ ʸ̽ ,wwxq f`?G30/.''!$ " "!"!!')%%"&wfPU[]W[\^\YWUWVTTXSMNTRRSYWRTY-H[^M?GUTM@6\TMOMIFGh`ZVTMF>ME=:JRWT=NSC.5MZCHKKLONNZYVQT[ZZRWUQM~K|Gx?rJ{J{J{K|L}L}M~M~LyLyKxKxKxLyM{M{LvKwIuEqAn@mCoFsEt@q=v0/R9  &/'')%$!*2-~+}1~1~2|6|<<6/,,.//'w){+},*~)}*~*~.& !}%&y r$y$y$y!ywtqopoomj~hyfwdubt ewev_n`okuoznu`merer`m_lfpgp clcgdich\aUZVZ_a hiol~{   "ysysqlb`ac$mqjespvs}?=̼> y||ȼлqW]>A //**$%!" ! "! %'$%"&xhT[]^Y[___YWWXYXWYTNPTSPTWWRSY:P]\PFOUHMVVTOG@]VRPRNNSd`ZTTMG@QI>AMWXVGWXK5940../.,-~.10/,+*~)$!&'("} w"x"x wwvsqorqoli|fwduct_qbtbs_ncnhsjrgo_kbn_l[h[h_k_jZe^b_d^d\b\`_c ijppol}{}|| }w{ olbd ko{yiiggto>lX"  1/µȺ ʼǰ3|S[!<@"00 ..&'$%"%"%!% $%'$%"&yeRZ\^XY[^[VTTTXVUXRKLQQPTUSQMTJU[ZSLW`P[`WPRNFUMORURUYb\VTOOI@LF?BKSVSH[`P<>OXTXWVUSOL_[VOQWXVRTRL|IzK|J{EwG{G{G{G{EzEzEzEzGyIzJ{K|K|J{IzGyKuIuHtEqAnAnDpGtCvBuA4"CdzZ % !03111,.241~6:630/0/,+/110-*~)}({$"&&'&$z w t uttrqonsqni|fwducs`r]o]o^m\lbneodm]g]g\fYdVbWdZfXdS^Z_Z_Y_Z`_deh lmppb`ro~  | !ts_abf lm`bppyt:ef0ŵ ¶Ÿƹ³̼/jv JR79!//,,')%&$&$&!% $%'$%"&sbQWXZTVWWWTOQRTRRTMFFKPLNQQJLPUW]XOOW`L^_PFSPINDEKSTRV^WSPPOLGFA>@GLKHEPXRB?LVZWQQTTSTa^UPNSURQRO~HxGxJ{J{GyG{G{FzFzEyEyCxCxGyIzK|L}L}J{GyGxHuHuGtCr@pApDsGuDvBx>8!$Jhq $ $ /877*))//.|.|2100010,(~+}*|*|)})}(|&y"v'&%!|yuqppqponnmmomh|dubs`q`rbp`o\lZi[h_ibl_g\c]gZdUaS`Tc WeTbP^Z_W]T[W]\bbffgdfom }{ | ys|w roab^a \]^ars}{˾ ƻjzM !ƶϿke@G30,,**%&"$"%"% $!%'$%"&s^NVXWWUVVTQOPPROOQKDEKKKLQMJIPVZ^YQMU\HY[MDSRLKGFLRNPSYWRONOKFB>@GJKID>KVSG?JU\UNLPY\_]]WPRWXRPQL|GwDvIzJ{GyD}D|D|B{B{AzAz?yG{H|J~KJ~I}EzCxDvDvCuAs>q?sCvFyCx?y=3!$Moz $$* *021+''/2-~/}20//010,(~)z(y'w({(|(|&y!u&"~{wrpoommmkjjiigzexbs_q^o_p`oapds^kZgZd[f\e\e\ebi\dT^P]P]O\N[MZY_T[RYT[Z`_dad`bkivv}~ {} wsvq{~snpmlkacca gg`bnm 6G*,zT˺y{:@0/,,))%&$%$&$& $ "%'$%"&t]PZZWYXZVVQQRTRQPSNHIOIIMOPKLQU\_\OIT^JVZSMRSMUNKNPMMOZTPKNMIFDILMPOJC=HUXQHLV_UQKT_ghWXWSUXYTQRO~HxGxJ{K|IzD~D~D~D~D~A}A}A}I}J~J~J~J~H|EzDyEwEwDvCuAsAuFyJ|H{A|:+ Nq`!  5&!&'*/*,04203//./10,(~*|)z(y(|,,)|$w%~{wu t!u sq"j"j hgee|d|d|bs`r_q^o^o_n`oandq_l\fZeXaW`Ya]fcj\cT]OZJVITKVR[U\RYOWQYY__dcfdfeesq~}~ ~ }{~y~ ysmisprpee^\lkacoo|ygcfdst (%Iou="mq 6;5/ ..++)*')'*'*$'!%%'$%"&rZOXXYYZYYTRPTTONOSNIKQLLLSRQQWLTZR?>RbLOVURPMH[ROSRLDFYSOKNMHCIMQYVUKDAKU[TGDO\RNNXcghTWZW[^^XTWTN}K|M~M~J{DDDEEEEEHHG~E}E}D|D{D{ExDyDyBwAvCxG{KJF;$!Uxj:! ""%2-/691240.,.//,)1-~){*~--)|"v!|y v&w){+y sl&j$h!fc~b|byaxaxbsbsbr`q_n_n_l_l`m_i^h\fW`PZT][b\dW_Q[OYKVLVX_ekRYPWLTNVSZZ`begh||$$|y~{   |y{| |yvstqsppmb_lkpp}x{s óͼ$JK  Ϳ=al% cf!/53, ..++)*)* )+ )+$'!%%'$%"&oWKVUVUWXWQNNPTLKKPKFJPNNPTWSV\AMTG36OeOLNWTMC<\XTSMEA@XTKJNKFBHNVXYULCDKX^SC@JSOJQ\ab`QVZZ]b\WXZXQNPPK|FFFHHHIIIIG~E}D|D{D{D{FyEzEzCxBwEyJ}MNH:%!V{J-4! '''(0+-420.30.,,./.+4.*|*~-*~&ys!|"x w(y,~+ymb~&j$heb|`z`w`w`wduductcqap`m^k\j\g\g`j`iXaLWOWY`T]PZOYPZPYV]gl$zPWLTJSIRNTTZ\`adlktsxwsqpmtq~{{x ~|ynkqn {x yvvs{yzxsptq|z{ hi ll&7<^dxy{vȵȺ Ϳ.Mmt۾ W]'./)**))&'&'&)&)!% "%'$%"&oYRWX[SUSSLJJJNIKGE>>@D:HKDMdswSYTKLQNJQNIE>>77:GJOTSG/PPLLNRWY8Yk^A'BZ[RLJIIOS=^DAmlSaVVRTZ`YRPPPQQOIDH|KHD}C}EFC@AEDD|GzK|L|EzG{H|G{G{H|LPHOI1 S`07+' * 7*'-..+}290+''++}/y"'}({,w.w4w!tt v{)~+z%q!if~!ili|gzfxat[nXkZm^m^m\j[iYf!WfSbYh^j[gS]KWKW%O\(Q\%LWGRGPJTW]ag$in"KT!LTLTJRJPPTX\_b\]eemm qoomso{w~ropl{ |~}wv~{{y no lmmk}? 3IXceh?ɲ>as]7ʹPL,*'&$&%'&)'*'*'*'*&))+') $'mXRXYZQTQQKIJJNHJGEABDIDG@GXjgSUWUNNRSKLLLPMLJD^YF*%>XfOPT[bhlifT$Hno[KJLJNR[bOZE<_kdrX\ZZ^b\SRRSTTPLEI}KHD}D~FHE@EFGG~K}MQI}I}J~J~I}KORJPN9aV!GR$"."* %) 6/*0/..490,(*/.3|""%(({+v,u*t'v!v vz&{'w"ogf~$jmi|gzfxbu[nYl[n]m^m\jZhXe WeUdVeYeWcT^OZKW"JW FR FRITJTNWQYT[T["IRIRJRIPJPPTUYZ]\^^`ccgf ljro {w| ||y ssts} hhmlxt%<ñ K^% kqS,|GD%%%$$&%'&)&)'*'*&)&))+&' $'mXRXWYOPMNHFHHMDGGFCGIMNNKO`keRTWVROQQPNLKNPPOL=ADFKOV^QW^hsyz{{nsoSG |wyt ~{plmilhrj9ź  n{qpxyI"um<: " $%"%$&%'&)&)&)&)%''*&' $'mXRVSSHKHHCACDH?CDECILQMW^TR^gmUVSPRSPPPK?BKW\b!Dcn\C!`abjxz{qv^8 XSZ]TbpfYZ^Z\^WNUVVVVSNHG{J~GD|D~FIFCEHHJKMQJKLLKMPT7CG6(gzL& ߪi!-/*.0-$+201.-0-./~8/+(*115~2/+,+*z%t"q+{%y vusngd"h%kmj~gzfxat[n"\p\o\l\l[iXgTbP_ N`M_N\O]P\NYIVFS GSFPDNENGPKVR[ W_KSJRIPNTRWTZRWOTPTOSNRST[\cc ki mk YZ dd psopvv|{ }yxtfc{ν=yqmhyvyvtqyt{wrozv Nm^fl;ƴ^Z,. ""%"%"%$&%'%'%'%'%'&)%&"&nWOQMK?DAC<<>?D;?@DCILSETZQFJ_lTRRQPNOSKF?GUbghiV<855FYkcWV_jqpu[[vrO9H0@RV_bXGQIWZKZk\W\]ZZ]WRUWUUVSLFFzI}E~D|C}EFDCDFHIJKMJKLKKMQU+=E4!awZRVS+ +$$*,(*-4**+(///,5}-~)'(//4}3/,,-*~(w!s+z%y vtplfd!g%kmi|fyew`sYl![o[nZjZjZhWfQ`L\!G[J]M]O]KWITHTHTGRCM?I=G>HENJTPZJRIOIONTQWRWNTIOIONTSWVZZ\]^bb fdce kk~x{llrq|~yushg ){söWO&3:{s} xfVa|_(}sGG " !$!$"%$&%'%'$&$&%'$%!%mSIKHG<~?~<~?78:>|:~=78:CCECHJPHHKTYSF9VPPSRLOTQKCHPXVNww}qpc]|r`E4>MZ_ZTlbKRljmgNER^bi_YSPbso]cb^^^b]ZZZYWUOILPKGEFFDIKLHGHIKHIJIIKOS=MP9Apn%', %'(-63*90,'(/-~1{*~(|(|,.,(~"y!t!v wvrmige|!ikfycv`s\oUhWkThRcSdVeTdM]GW$EZ"EZGWJZKYLWJVGTITJT KVJTJT GSEPDOIOKRNTOTLSKRJPJPEMHOLTSYZ^\_\]ZZZ_X\ ccro{~us{ywvnmmmhj{vts lm klnj|K?n_/ñ}wsrnyt A[sVѿ\W36%!%" ! "!$"%"%"%"%!$$&!" $eyJ?C~C|G?>|:~=78<>ECDFGDHJPBDIQNE>>ZRPVUOOTNF9AWiwy|v^ix|vcQJXiwzXk}}t}sfM?MbdQITjrb\VJLW`_^`a\[`ab\\\[ZVPJQTOIGHHEKNNIHGHKKMMMMNQTCRT<*_: /,"'('&**.45-<3.**/.1{-}+{({*~.,'} vs u wwsoj!ie| hjexbu`r[nTg TiQfPaRcUdTcL\ EW'H] DYCTGWO\S]JWDPHRFPEODNCNEP FR"HTLSQWTZSYPVNTLTOVBJ?HBHIOUZ\_X[STW]X] gh{x omrp|{|{usvwx{ qssneehkrsify~6pX Ʊ)F yx mmroxq Bo}OƴyKI%*  ! "!$"%"%"%!$!$"%!" $TpD{44}A~>{3{4z5~44457>MH:' )`eTJP\Xm||mWy?J|[HqIovveKJey}vvjb[UYZJZ\[VUVTPK~LJHD~?~ACDFGHGFJLGJKKKLPSEE@7+HZ?,.  + '!'('21/111/)/({&y*z*y(u'r)s-wnkq$w urrke|czdz`vVkQgTgR`Q_Q_Q_R`Q_M\JYO]JWFTFT"GV!HTFPDMCKAI@HAICKDLCKBJ$HR"KT NVPTNOILHHEGIMINJOKPKPJOIMHL RTNRTVfgxw~~zxsp~{xsws~y{xtrprqxs|wxsolnmz{qpƶAl {|wyvsp{w fbuskh%)GgM;&if79 "  !!!   ! "VsD|54C?|5}5{5~45668>JA70CZkvGHGCHIKTUMHMMHLU_b_WQMKMmrqwAn[kgV9HCK@H>E>E@HCKDLDL"GP$LT"QY TWRTNPJKIJHMKP MSLRINEKEKEKILIMRT]_ ihonpmol{|x{ ~{vssqxt~}~y|yrohh lm^\ ȸ²^/ |~}w|}Is>*\Z//       "WtD}56D?~7~6|67777;@<6:Lctr~kg>EIIFEFMWICOUNNWqk\VNOLOgeiTg]UmcH?U[VVUcat{|zh=o>ZZqS%lgi`STiw{hukt\M_gfm^a^ZVVSOK~LJIFDGIJKMMJJJLHKKKIILPIIA5!OQ!2) &' (4/)%*.042/+))+)),'~(|*~-}'v&s&sv"|'| ts(u$qfie|e|dz awZoWlWkTbR`O^O^Q_R`Q_O^Q_MZFTCP@N?JEEAICKDL?I GO!PW"UZ UWQTKLHJINKP!NTLRGLDICHDIDGIMQTWZ\]bchhmlzv|w} |tqolrozxzwzw }{sscecew'ǺT?88  } ˹;Lz4ϿII !$ !WsC|3~4~B~>|5}6|7799:>C<:CNOGA>ATA>NPLWhuiWOOLIJG_`^qy\gifKFT[WUUaZjtxqDk-bqejU?lZbb[Xgu|xat`{\Idnht`a^XTTQMI|J~HHEEILONPMLJLLHKKIHHKMKME9"HM%bM!7!$"5/'$)/052/)''))()'~'},*~'v sqx&( tm$q'j^xe|czbyaw_uZoWlWjSaQ_M\M\N]Q_Q_Q_R` M[!HW CR@N>J=HG@I@I@I6??HJS RW SVNPHIDE!HM!GL!GL!GL!GL EJBG@EHJNRTWUYZZac kkqpvs{w~ {tqokhhponmnm rs mndf hirj{zsѽ%N݂q4Ķ}<<  !Tp?y/{/z?{:y3{6|779::>CPE<:JWadGNTQKB::H>?ILNd|o^ONNHGGAZQtiwYN^\K9HQLKSTEZmrxkTt(qcjcXOlS\a`_iu~zkr`xZHeldzp`b_YTTQL|GzH|D|D}C}DHMIKJJFFEHDEEDDDEHEE@4*x?a۝'(  '-*!*/41,'%%&&&+%"}()}%wqqt$'sm$q%i^x`waxax^t\rYnUkTgSaO^M\L[M\O^O^N]M]KY GVCP>M>J?J@K8A8A:DITTTTSNF<6>A>BGVodVIJJE?ERMJAL:B:B:D=G?I>H;E:B4=A!CG"DH?B:;?BINPTLROSZ^bebepoutywvsusvsvssqhh mmdf[^\_]_abpox|np{{|x|w{| I_r?,+WLf~>տ2pk//    Ok9t)w*u:w8v/y4z5~679:>CADMGB=<@_YSPQNC;5BD@Ia}dRDJI?@KYJ5sgLifhQJBM ?I=G:D:DH DMHMHKDHBD@B<<==>?>?==<<:::9CCEDD@KT]`ZRPTTH>8GG@OlfTGGF<>K_^KrcGakmO2BRPL>IE_owoW-ʁRZTbWk[imoeahslb`hkrhR_`^XUUSO{K~KG~E~D~DKOGJJHHDGJCFGGGILPNRNA(EJDE7;'.+()*  $('75300/(&:/&&%&|&|)}5~*up s!vql kj'm)m!e| bx%bw'^tXl!ZgYfWdWdWdSaN]KZO^$M\&IY$CS H?$CE @A883254::>A"V[.eh Z_KPNTX]^b^chj lmhhggmlpoon ccgf^`_b mnoohgli adpqvwzy~}{zyzvwp|tzt̻ӿLYbe|UƬVT           Ki5m*o-n:q/q%u+s/z499:@EJLMRKIKVeXPTZSH>KE6T^~gNLJICE>E=E=E=E>E ?G ?G!@J!@J>H=EEHLPTJFGR`WPVXTJCMG2Z_gTI?@CB@A_GOlnidRKakSCAJ\VLFOf|pZ|7oGti^dlxb`\cqvma[isn~e~^^b]]``{]yXxQxNvL}K}K}E}D{A{C}DNNQPMIECPNLIGIJNKD;333 b+  "/ %&$' .,*'%"}'}'}"|y v!u$v%uplhjgbyax`v\rVj TjUiSdTdZh]lWdJZ"J]I\IYIYIWHT ET$CS ?I ?I>H>H>H>H>H>HH ?G>ED=B@DHINIMINUWbfdf [\mkmj|wpkwsnk|tro`dZ^`bifqn }{wkhihnmgf ddtsusts~ zx @h|yEǻ/YY//            Ih3i'n,m6n-p$v*t/y3678>EAKSTIAGOUQOTUJDAPK-`bg^MH=GEBTK'_`}g`O?AHKHFPDIW`b]ZhuXbBK[SP\rvO:S닒UKkivoghhks}wjgtyvyqtvsccec|a{]yX{TzTTQNK~HJLKNQPOLLKMJIHGLQUSG874/b7  $ &'%(./-'""(')(%$)+,)%!}yx$y$wrnqqmd|bybx_uZnQgUiVgWgZh ^m!\iTc L^M_O^N]LYIV GT"FT@LAM CN CO CN?KD:@5<2: 09:;7::;?EHLQT^^igrm xvbeZ_ Z\gdyt~ihkjz{kj ]]qp|}z{ Ȼ10/Pt}r\.mh79             Dc,e$l(j/h&j"u*t-y0246=E<>SO,VY~g]SHECBDI%,3AOV\cv^x^nNK2Hgy{`LDZ~RWugb\dlllt}ujfppylonzsqfs`cb~`y^xZwWxSyQ}R~RN}K}K}ILKNPQLIGHIFFFELQUQD:<8,KH   &*&%+  "'"!(*)*%!~zyz"xsnkkf^u\t\rZpThQgXl[l\l\j[jXeP_H[K]O^O]IWESDRCRBMCN DO DOCNAL>I>=,qV*. %'&*$ "$%%}{{"}!| wsije~_v\t]sZpTh Rh![o$`q^n[iXgS`K[GZL^R_P^JWERDPCRBOCPDRDRCPBO@M?L>HA>D=B:@7<4:29/8/8320/2379=@?DEHLM{x  {w []\a_aggii YZW\Z_\`X[SVZ]bfdhwvxwoomotvrqvs+^VGNWhSѾ6"{x=E $                ?_&` h&h*c!g"u*s,x-}//3EC/ XcE) 7  ! )%%$! $%&{umomgf~!e| awZn Tj%]q$`q]mWeTcR_L\J\P`UbUaLYHTFSFTCPCPCPCPCPCPBOBO>H=GDOSTPPOLOW[XPOH?P0Viאphb^XONQQpqfmpu[J7Cg^/WL>@Qdsy爂RI{5MMVi~dsyt~ys~t^Vpzs~m~rrmydebybt^rYsXvWvSyR{S|Q}P{L|NOE~IKNKLLMEFJMNPQRPB>IG2IjM"  $*"!!$$"'-,*"&&&ytnp p%k&j(i$dz]q Uk%]q$`qZjTbRaR_P_L^TcYfXdP\JVHT"IWCRCRBPBPBPCRDSET=G=G=GEGkcqJ~@MVEQYPKNNL?H]K1AZ~~cJEA;APJRfywYKHx}p>kRKNU^hqvmwpT6z0[YXc[`iuxhrhKb]hpoi|qxP|jxftcpbp_p_pZoVkOsTwQxLvJwL{NJL}NOOJIIJDEGJMRPNRE=DJC6$,wA$ !  )   }yz vsomie|by\o\p[nWiReM_K]K]SaQ`P_M]K[GWDTBT&CP$AN ?L >K?K?K>JHw,M>Jt\`elvsgsnTocdlos{wx[{hvescpcqarbsas^qOpTvQwKuIvJzK~H~L}NOOJGIKDEHKMQNNLB9>E?2&5z5    }xxvqnjg~cz`w_q_r^pZmUgReTcTdQ_O^M]K[IYEVBS@RAM?K>J?J?J?J?J>IPS)'                4TfRp]Zy!^z"di"q(s.y+|*~08@K?ATZoLf<"HORMINNKKO[D9\rsqkbUK:GKXjxofG7|NzvQ17SPQWajqtwlJy,O,IZeflrxv}o|zo\}i^gkx~whxjxhuesdsesesdscrNoTtTwMuHuJzK}K|M~NOMIGIKDFJLMPMNL?:AF?0%C;   !{zwrolidz`w`r`s_r]oYlWhUhWgO^O^M]K[IYEVCT@RCMCMCMCMBLBLBLBL=I>H?I>EA :?8<7;59596:7;7;:67444348;>DBGDHKO`ayt&"|ohbdUYHOEMGOIROTSW nnqphhih{y ~wsqm|v~/[yy}Ճ`0ff<=                5TdRo\|[w$]w$ei"q*u/z.~-49ANEAO^\K4NRPOLNLQGIX@+=^SgofVVL:OMUbs{}zh;~JwF\QTWU`gkk{u}qT4](OGoiqtuv~si`mefknr{qvm{lyivesdpbm`k`jQnSsTwMuKuM{L|J{L}NMLHGIKCFLMMNKLLC>CIE6'OQ6 $   "~|wtplg~dz`tcwewdv`qYlUgTfSaQ`P_O^L\HYFWDVKWKWKWJWHTGTESGT CN!DP$EO"DNAH?E=B=B<@:=:<7:7:8;:<:<>=<;:97::?=BAGDIDKNSWWqnsn ^[ cb igX^U\RZPYOWQWTYW\mlvvssnmutss dd ]]}(G1Wsyy}Y/}NP +,               8RbPmZzXt$\v$chn(s.y,},28?'HWN}HKTRMMLKLGJLDCP=$4EaJcs_IGE;GEGVgrpk>qFl{:hTVYZ^fgd{v|uYECHEKEM NVNS\_]^RT\_\_LTRYV]W^W^Y_^b_diipomlii jjce ij${}||!$\VgtyjJ"cc76             4N_LhUtTp!Wp"_|fj!p+v*z(|,39LeOy,&IXKGGJHCCBFDN<,>Megwv_A==6>E?=?;NZms^LGD>>AAGSbd^sZ?fR^AMY`_fopfqxvyu[F4Z/ZI_mkbbnx^z{tonlc_gyatctescmbg`dddfdLhTnVsPrNsLvLvIuGyGyEzCx>x>zA}F:DLLFDBDF<9CIA57p_0   $!!"zwrnk$j puuofw]q WmO^O^M]L\K[HYFWDVNZQ]T` P]GVAP?O@P@NBPCPCPAL@H@HAI@G?E=DE?A@E?E>E=DAIGNKVRWOTBEKOQTKORWJPX]^b^bW\SWSWQVKRVZ_bfg nnrqhffcusı`ߎu֊K3\]34            9P_LiWtUo&Zp'c|"hj"q,w+|*~/49b?1W_M)MGHQRJDGLHPDCZdzzeXRNOHFNMQZimgl>f_Wo JY`ckvvlscG3P)GSkztjiwt_~|mj_ni^c|gyhyivfp`f`aa_ebJdPkRoNpKqJsJtFrGxGxCxBwE=D>E?E@GEIDI CH?EEDMIRJNQTRVeh^aHLRW\`Z]_b`c[^Z]\a\aW]gkhlbe ffvt|ƺ?/tӃ/{yEG             3QaMkWuTmWl`vgp's(w+z)|)17<;;ACHR\J?9?GHEFLQ>>6QOރ{`RJ=L[RMJP\a^WsyPfQڂ\CK^T[osfcls}sfw:}*oD?c^T[vol|vidcP{XbrpfufrhlhfgbfbebdbSiUjRkOlLkGmIpIrAoCpCpDrBuDwDzE{CEDEDECEBCGFB?>?CKTLD?>?A?CFK><6RR{`ND:>LRONS\a`\kuInL~bDCWRYhlgirtsvnU6t*^K>a^T\q{|mio{pr{yozilcvejctfrejecc^_\[[[ZOeQfOhJhHgAhCjAm>m>m?nAp?sCvCyDz?}BDCABCE?DCD?<=>:. >;VY߂fUG96:MLMQX\_^j|JJytXHTVZbcioqylzhI1^,H_G`c^^otvn|ivzj|rsvssY]Racseqdjcc`]\ZZYWYNdOdKdIeCc>d?f>i9h:in>rAtAvBx>?.C?AU\zybMD>=MMPSX\`acNCjbqPR\^[^lrpvi?.OA=Zbmlhnqtt|l}b]ftsu_\WXlascqbleeb``_]_^_OdOfKfHdCc;b>f|ABGJILJJECED& CohZZ*%    ! zxndx`u]q`t^qYlXiYhWfTcP]O\KYJWJWKY!L[!M\JWKW LY LYKWJWHTGTDRDRESGTHTJWLYNZIVJWKWLYOZQ\T]T]Q[X_^eeidi`eZ`T\V^X`XaX`Za^ddhhkY_^cy{ ϺBb~^ʾ${s"7778DLMyOROE<=IC6JA>K\onVIB9RSTV[_dfZPy4TDށ݀UNWYW_ovp{z{V4r7RoG__tvonmp|wpuqWwR]onzbjblcvbsdlcgbb`a^`[_LbNcJdFcAa;as>t?u9s`9`:a:d6c7fs>t>t;r:tm?p>s?t>t>t:q;r8s:tfAi@j:it>BKI= Ehiwv_/       zyx(u,sezg|dx^qZn[n WlTh[eYcV`Q]O\O\P]Q^R`R`Q_O^Q_R`TbUcUeUeUeWeWfXgZi[i]i^i^i_i`j_j_j_j lr jpgnfm gmhnkpnrlt]fW`dl w} xt75Ĺ+HxZdib;bDPV36?AD@BDZOE>4)6>El}hb_UDFO^kZ~LxoT.ddpodW^jyo_i{^RR_lqnSgohsbzcc\k{k|hycvdwex^tUl_pZlVhTfSePdL`I]AbAb>b<`9`7b:f>i7k7k7m:p>s=r;o6j3k3j3j3j3k7n>tCx;v?zECA?AF:HD- PyrqZ!c   ~|yxpl|gwductducucu[f[gXdT`T`WdWdTaXg[j[jXiYl]p ]r[p`vcyfyhziyix kw mxht mxp| ny juhs kunx ltoxr{r{qypxqys{ ir{~yy z}5bW\qgEv{T_=E/2**&*%)$'"&!% $ "!!           4YjXu\|Xs Zr `yaejps v {%*)&*-49ER;?BGE@ACTG>3/-179=Nh}{wlW;A^twc}^wksZ<.:CTZTO[jqzfQRapqlWkn_Xdkgwu|pyhvbsdwdz\tQkZoWkShPeOdNcJ`G^b>b;a7b7c:hb?c?f:f:g9gm?s?sAu?t>s;p7k4i4j4j4j4i4i4i9m>B/AMG.+SrpO!!<     ~|!{wrn~k| jzhyfwhvfubq]m^n aq`p[k`qctct`savez!ge|d|hknoq tv twz{ yz {~t~s}q{q{r|r|q{oziupxpvtx =LJ:"؉p!ɻosIY!:K3B5;8:,2+0+0*/)/'.&,&,%,$+$+"*!) ' ' ' % $ $"!     4YjXu]~Yt![s!azchn!t&w${%}(/01153(,/5<=@7?=714OA2'3Kdsz~pMCZqt|wgPL^mi[\`YId?f=i>i;ir?sAuAu=r:o7k6j;k;k;k:j7h7h:j>n:o>tB{CA?@@7CKO<&7\nN!     |xtq pn~ l| iyhxl|!j|du`qascubthyk|jh|i"n"p n nqsuvx{}z{}~~   }vssrrrp|vx{ ( 8ʿ[_KJQtM ^e CS)8K(6G7@:=.5,4,4+3*2*2)0)0)2'0'0&/%/$.$.",$+"*"*!) ' & &%!" !4YjXu]~Yt$\t"b|dfkq t w!{$-$'/55.%&+0745::@557A@<557??@8s;p7k4i4i;i;i;i8f6e5d6e7f4i;o?vAz<{8{:>D=>ED3$%Bhi%    yv t r rsq pfwk|l~fw_q`scvex i|ll jkpqot uxyz|  |vrp~p qnz~ }|~/xyqwYesyK& imLW >M'7J$5E4?4<.6,5,5,5+4+4*3*3)3)3'2&0&0%/$/$/&,%+%+$*")!'!' &%& $4YjXu]~Yt$]u$c|eekq t v {$,!,6<0*.)/4246:8779BC>?G,9KNLD5,7PRIM[gBGPTTU\eIV[XWahl{e`_ejh\T^`b`aemsrbU^`YWxZv[vZtRsQrNoGi@c>a?cCg:fl>mrAu?t:o6j4i2h7e8g8f5d1a._/`1a3d5k dmU`DR>M$:I 6E3@2?0:0:0:/9/9/9/9/8+5+5*4)3)3'2&0&0*2)0)0'/&/%.%.$,') !%4YjXu^Zu$]u$c|egms!u"y"|%/&)5@A87704241./4@>ADDEJT/4/$-j;    }|xvom i~f|i!m le|twwu v'|)'}"}&%! !'! {y z  û`sf{tIƴ~WgL\DSCP!@M:H5E5E!6@!6@!6@!6@ 5? 5? 5? 5?/9/9/9.8,6+5+5*4/6.5.5,4+3*2*2)0)* "&7WiWu]~Yu(]v(d~ fchn!s&{$*-(',./!+0 AWUD3::<=HUbQQSRRPRTD`neTUixof{ZJUqwkdV\YWZ\\W\]VS~Q|V~U~SyPwOuJrEmAl>j>i>i>j>l>m?pCrBtCuBv;w:v8u9s:q9p:o8n4j4e4b4_/[(X+^/f:g>jAoAq>s?tAvCx:x<{<;7:>A$ ]5      {|{wrrqnjjm!nnt wwy~' (,  Ƶ̳5MadbqX  gw$O`"K\ EWAT ?S >R"i>i>ilr>t>t8u7t5s6q9p7n7m6k2h1b.^/[+W%U~&[+c7e;i?m?p;pJ^]cxqHz_p!P` K\ EWCT ?S!?S$>R"

N>NHLFCJV7><764;JU]cONRRXRJ=K`h]NKYbz_\T^dZtTsbQTWX\b^WRSPL{P{Q}QyJsMuJsGoDm?k>j>i>iot?u8u8u7t7r:q7o7m6k2h/`,[,X)U~$T|&Z+b5c7e;i;k7k8m8o9p2p7t:y8|3~5:C:bߖxXJ    ~{z}$"}zxwu!|$  7Jlo?p@q>r>tAv>w>wt:q:o7m5k1b,\.Y+W&V(\+c1a4c7e7h4i4i3k6n4n4r9x7{7}7>DN3?|ympH)     }%"!|!$   "  BQ?Q`omK$revZo!YkUhQd Nb$Mb%Ka&H_%G^$H\$H\"G["G["EZ DY CW CW$CT"AS"AS!@R ?O>N>NN>LCJE<@FD6+>QVD+F74GYab_IRZZ[ZM=W`b]WTSO\^WYb\\jPTUXYZXOTURQPTRKxEsDr@p>n=mr>t?u=v>w>w=y=y=y@y?u;r:o7m7m1c,\.Z.Y(X)]+b._2b6e6g2h4i4k4m4o7rBFT?`~xcI+   !!"!! &" '3% 7V[F]rrV;" j|dy!_v\oZmWjTh!Rh"Pg%Me$Kc$Mb$Mb$La"K`"J_"J_!I^!I^$G[$G[$EZ"DY"DY CW CW CW DY CV CT ?P>N13FTVTO:N`fe`Mn>o?p@qw>t:q7m5j5k1b,\/[/[+Z(\(`-^1a6e6g4i4j6n9o9p>t@y@|;}>BHHA1 r=q=q=q?s?s=q;rN!6B:Yk!Zw`[w*`x+f$if"i!p%t$y%%)/+/-(!D+4QWH7ADIKE;:@]? >^hT&<74BG@734Q_XSZ[YUTTW`bT=r>r>r?sBtCu?u?u?u=v>wt:o6k;p6g4b:d;e4b/b+b._2b8g:k8nt?v=q?u?y?z>|>BE7GM:.Zݙ{iqaJ        !!$, %!&!%% Xxmca[x].{!q&n%r p!i!g!e~&d~(d~)a|*^y&\v&[s&Zr&Zr$Yq"Wp"Wo"Wo Un$Tm$Tm%Un%Un&Vo'Wp(Xq(Xq+Xo)Wn*Tl'Qh&Mc%Ka%I]$H\AW?R"7D:]s[|]_*c"dh!o!r'u&{$&,5((++'(6*(25847:98>JIHGMHEDEB7AIE80:EME?-Qhg_YOHB\jhc_P6LIGJQSLFPLIIHMQRRQOOKLM~O}DzG|Ez?u>tBxCyAv=y@|A|A|@|A|A~D>|?|A~@|>w|?|?EI?AGE7$Zs~ssdWcpg<TX7 )  !$""  (*''&!%%$ )%2K^myjI4:&$v,v.v,u,u'm'm&l'i'h)g)f+d%b%b$a$a!`!`!_!_+^+^+^)]~(\|&[|&[|&Zz$]w&\v"Zt$Ws$Ws'Wr"Rn$Ol Tr"F`3K\;^t\~_a)f"hjp%r&y(}&(.0''*)%&4'%147257:17A@8EI<8BNNJI*J`e^ZPGKV^\]\O5IIEHKNIGOKIEGLNLNKIKGE~IzIzDzG|F{Av?uCxDzAv;z<{?~?~>|>|?~Ar?t:t;w=y<{>|:}?Caw!_b f)k$lnn$t)|'()*-'%(&$$0'$/15.244+.4554?C<:<<3:AD67EJ>>J)DW_^XLCRSLENVKwB{B{@y<{>|?~?~>|<{?~?~:|?|?~@|;w7r6q9o:o8n7m5k4j4j4j4j3j6n;s>t?v>t?vAv5q7t|9|:}>:?DE<-,/Di~ot?  "  $&!    ;Y\hp|f0 +/~-x&u&u*t*t,q)o(l)k'h'h$g$g%h%h%h%h%h'h,f,f+d*c(b(b(a(a*g*d(c,b,b-`)]|'Zx [~"Qm6SfAc|&cf%j.p%pts%w%.,)*)*'(&%$/'%/15.24/.,4<6D67HE5:K3@NZ\UH?TQF9:GICDE@BCEECJFFDDGGEJLIGGEGGDGHA}A|D~C@|<~>?><~;}<~>:}>A?~|:}>?:;CGC:7> IlK   ! &$$ !"" $ISsxuD $44.~(|(/y-x.w,u,q*n*m(l&j&j(l(l*m*m*n*n+m+m*l*l)k'i'h'h*l)k'h+h/h,f.d*`%b&Yv:ZnCd*f j+p1v'v!z$w$~*,/*((.)*(( &/*%145.227..484?D?70695:>L?DOM>CR>EMRUOC:NLC74??<|3.3859;DCEHHBCMDBEKJC;:GIIA<:?DCA??AACCEA@>BBDDKJHEDDEGEIIEDGD>BDDB>>>>:<>?@~<{=z=z:q9o6n4k4k4m9o:q4w9{?A?>;}:|C<>AIHHHP$ %Lws[=22: -     ""&$     AVfzW) )+/88-,,22/03}/{1y/x,w,x,x,x,x,x.y.y1y1y/x/x/w-v-u-u,w+v+t+t0u1s/q*n'p0iCgHe/j'r/z81"()/+,$'$0)'&("$+%!(-.%)'3,,/.:/%/617747807?=5C<=B@97>?==<>=BBCBIHGEECCEDHJEEEE?DDDB><>>4}6>>=?~>|>|:t7r4o4n4n5q7r:t6y:|?A?<~:}:}AHGEJNM:VzwtuM,    "" /KWfv~|Z/-1/4<;2,.54343144,|,|,|,|+{+{+{+{/~/~/~-},|+{+{*z,|+{.z.z2z2z3v/t,u5pGl He/j(s2|6985/1><?;<;9:8<:7771{4}<<<:~>|?~=v:t7r5q5q7rw7}<>@><<<=v?{A~CDACCEBADDBHK^H><|>|<{:y9x:y>|A0y7~>DB><:ACGGEEGHA?DGJINVMI?A?<9Hu~zT+?!%R\= ĸþ !"'  %  9Tboz|~sc^a9&(689<98:8;:99;549:56:61144/141133344496446532I}{9>wu4}EB/4/-(!!!&&'%! '+%00((01,,11,*0+,%&%')28573467;;786::74:88:>>>>95557752:@>=>AB<::>=<>ACGH;};}:|9{6y7z;}>8=DFDA>>?BDEDCDGC?DHJINTLIA;7/*-x|~oSRcl]C>T^@ $&" ! "  )!<>?><9K!~7A}~;:?CCC>DFG?DFDDHHDFFDC@><:><=:>>AA>>>;}:|:|>?8<@@><<>;>AAAACCBBEHJFKSKIA=0 &P`wu|zbkhL$! !!"'! &HXY[CTit[P?3 )370388<9:8<;875<;769<649946<:::;;;<<<><:<<:>>:<<:77:<477777;>;?ABBBDDFCDHHFKNLIHC3"1 3SnoU/ 'DNUepstrcmv5$ $$-773,-::88<9;::669:::<8337745::::<<<==<=<=>>:7KAK+EC A*-/,*%'$&'"&$+)'(%(-%$,('))'(/&%$ !!!,,0.02334/.038674313474354458854::968BDA>DE??DFDHKKHHJIDGEEECA@@?AACAA?@<>?<:9:<68::;>BF>ADEEEFHGHGJHEHNJIKG:/1?1Oj|a;     ! 7K\||t9  *17::7/2337<::886;848<=7:?<66:<9:>9999:::CCCCBA@@>AACACA@>@@><::<8:::::88955;?;>A7227857<77999:::<<=?A?:5L*KM(ABA()-)&! "''&$'&*++%(+% (4-)+) %+$"' &%%!)('**//(*'//4142.,./2.,-,,/23/-*21/4<<78>A=>:>>A@A?A<>?>:88879::9:>@:=ABBCEGMKMNJEGNLJIHGBBC3)%V{|wuwXG9    Ak|c< -7::A:74+4@KK7<:;7<::748<>:?B4//4545;;<<<===><=>BD@:5K'JO'?77>==<@ECCGHFGKKG<<<<<<<?A?<:::@BCA>>>A:>>>>@@ACEGE?:M'M4E):**+.*+,,+,*/1767+$%--$!(/'!!!%-*(),<70+***),**-232/-,'),,)&52//22.+-,//5574;??=>BB>CHJFEILIAAAAAAAA?AAA?==??A?<989;@ACA?>?@8:>A@DHKNJLIGDGPONILG?DM:541+~|dJwK$" CVH1hT85Ww~c2 57;;;;>A<::>DGA>C@<<@@<<@C>>CDACH9779>?><:7H9C3G.>$(+.0--.,+,(-.302'$%*'$$&)!%)!!%5/*((((&'&&'*,)')'%&''&%/,++..,)-,//5574;>?<=AB>CHIEDFIFCCCCCCCCAACA???A<>>:777::<@@@CFIKHKGDBENNLHKE>CJ;78. bp{p]b2  4H[haN^K4<^~s`@&936::::>A?>?CB>ACACI@>>@BECBDB@@AB??>>AB>CIIECEFDEEEEEEEEDEFECACD>@@>::>@?ABA><>?<@AA@BEHJGJGD@DLNJGJE=?E<:3)/DbsW$0/KYfqxxleVHTsx2 )>F047:7:=@?>ACB>?EB>@DFA>A@==@@==@A<=@BECBIGDCDEDAG?D4%N4"A-(-1/-//000,-*,&&+'&)' '" !!!!)'$$'''''%$%''$"''$&''&")(&(*-,*/.//5574:>?<>AB>AFHB?AB?CCCCCDDDCDFDCACC????==?A@ABA><>@ACCCACEHJGKIGBDLPLGKG>?D>=9/" >g|pR=4&'@TQ7+fsupz~jYP07:>>>>@C>=>BA=>EDAAGE><@A==AA==A>::>@=@D6334:<:7C?>>??>=I?E8%O3%D--0,-..0666//,,&&/($(& &$ &&$ ! '*'''*--**('(++(%*''''''$*)(),/-,/.//55747<<9:@@AAAACFA?AED?AIGCCDB><@B>>BB>>B>::>?==>@DB@EB??BC@>KCH;'P6!B+-210..-27700,,&&6.+,+"",  ((% %$$''%$%*+*'%$$%(('$-)'')*''.*)*.0.-/.//55547<<9:?A=AGIB?DDBBBDDEGGIGIJIEDEGACCA??ACACDCA?AADEEEDDHJJHMLJEELPJGLMEDECIIJB7/&Ea{}srv}p^Tnw~{swvoj^N5@BEEC7)CEGHGHKNEDEJIDEMGDAE?:7;?<<<>ADCAFCACDEB@ICG=,T4!A+0//1/00544--))!!8/),' "," (//&%$!$$-'%$'(*(%$!!%(+'%-)'')*'&0-**-.-)/-//555415745;<8?DGBADECBBDEGGIIIJKJGEGIFFFCA?CCCEEDAAADACCCBCFIIGLLJDDJLGCKMHDEDIKEB943B":\lysaak}znZlx{~w^A7,%*+@><:7;DGCEGGGGJLDBDHGADIGAAA>4.4>::>>::>:66:<9:A:99:>A?>EB@ADDBAJDI<.U4A+2/04122322,,'':1+.)"&.&/."!!%"'*%$$%((%$ *)''))'&0-**--)&/-//5554/44139958=@<;?A?>>@ACCDFDEGECACDGGGD?>?BDEFECACD<@AA@BEHFEKLIBCHIDAJLEDDECA<947:S6@Ors|oJQg{Qan~{zq|V0FU1,"*G]lDGIIIIKN><>BA;>DGA<>;///:44::44:<44<<:<<>BDBAB?<>ABA>KHEHD:/$*11/0,/***,,,--(!!$%%* ",," -($$$$$$-*'(*++*$!%$(()'00000.**"$&&(/.%49944:<77:>:=AA=DDEEGIJJDGIHGEEGGJKKIEEGCCDC?>>>ABDDBBEGEEDLLJIPJHJMKJHMIDBEGEIP823-$$+<'3E\w\foxvucBA?644AK?99<>67<<<;;::77>=;=BCCB/]$JH?4(.742402///-----*"&&%%%*'"'//'"'.*'%%'%$+(''(**( !$$! $ $!(*'&00110.-*$(')*10-79944:<97<>:=AA=EEGIIJKKEHJJHGHHIKMLJIIJFHIHCA?ABDEDBDEHEEJLLIIPMGJKNIJOEA?CCCDK<3*/)'$.">Xrwj\e_YND477248=DEAEHJJJLMKLLKHGILPNJONEHMGFHGC><:7=CAA@@><=ACFEC1\)KIA 6,197662400//-,,*,"&&%$!'" )) ".*'%''%$*'$$'((' !! (%!%*)-)---.--*)&&-(+04,477147977<><<@A=DDEGIIJJEHJJHGHIIKMLJIIJFIKHDAAAABDBAADEECFIJEHNMEFJKGHIEA?CC?CGD7-/1',=N^jqxdQ/ **00017<>>DCADGHHHJLOPPOLJNOOLINLDEKECGFB>;B<55AC?DI:57;95/9BB@??><<<979>@@>5b,JG?6.4:7662420/-,(&&* "&$!!!" '' "+(%%%%$"*'&&'))'!!!!!!!!%!$''-)(&(())(&&&(&$'1-+/30-/45047:79<=:AABDDEGGCEHHGEGHGJLKIGGICFHDC????@@@>>@B@@DHC@AGIDDEFABGIDCEECCHB;8752!$($ &?MclzxlmcQ:*.9EI47=DEEEECEGIGGIKKMMKIHJKNIGKJCCIBACE?=:@733??::A73472-,5;::76443<::<9947542/-*((,$(+'%!$"&&"-*((((%$'&""&''& !!!!!! '%'&**)'&&())((&&&'"(1/*/33-/4507<=<AABDDEGGCEHIHGHIJLMMKIIJCDFDA???@AA@>>@BCCCIE>?FJHCIG@@DJDDGGBBHBACG?407<. *6Jdy|k_L?<<2% <;:?CHLSEGJJIIHLJLOOMMOSOPPOLKNONJGLLDEJECGFC???>4f/ LL&H.A7<<7877540/-,-(.//*'**%%**%%*.-++-+(%*(%%())(%%''''%%%'$())')())*-*****().44/054//57493'  :OakourcK=3  +:8=<64:6//888:::<<<30039<972f& MM(I/D49><9945420/-,,**$,//,'*&""%%""&+*(*+*%")&$$&(&%$$%%%%$$'&(&)(+(%%&())(((*,(.53-/30-/3408>?>?CC?>>?ABBDDADGHGGHJJLMMKIIJCDFDA???ABBA?>@AEDCGD>?DKGEIFC>BB?@DFBCFHBEFC=A:2984/65-.4579:<>??6306:=;:&e)KL%H,A,19400,-,**(&&$$ "+('$%"!!"$$$$%$!)'$$'('&!!"$$"!!'$&&(,)(!"""!$-((*0/((-+&(-/+48:98>>8:::<<>>>:<:<>??<:7:A>:9>FCACC<<:@EA;7;:/04*'(,.')'0057:>?A1//17875&a$>>@CCAABEILOOLJLNCCB>;:<>=<::<>>?:::;>?CD;6003487+--159::)'&*1/4.>ED@?FD>HNRNPSRLY[[WW\]ZZZ[YWWWZWWXXVVWXRTRPOKMNRUYWSRTWLOQRNMQTHGILLDFJ@?:A@2-2<6436,.5-'-64/&'$$$/2977[2@%[-2G4198:63,,/--+-/12 $+! %.'$&&&(1%%(**(%$&"!$$")'''))'$-)&(-,-*%""%&$$'*-(+33.&*,&,27445579;;<7:<<<<>?>@CCAADGILOOLJJLIIHDAAAD>@>?>BBBFBDGGDDHGCBEDAADMIIHIHIHNJFDBCEC;;<=>BCD<84:<><<000224444344<<;9AFJCEJICTWWVVY\W]``\\`b^]]][YYZ]YZZZXXZZTWUUQPOQUY\ZUTWZPTTUQPRTJILONGIMEB?EC507@79::2573--;:6,/),*48><>^6@%Z-1F469=87//(-++(+-//+($ %.'$&$&&+$%'(((%$'&""$&&$)''')'&"*(&'-,-*%" "$&$ "(*$(00,!+)**2451144568869<<;;>?>?BBAACFEHJJHFFHFFEC?>?A?>??ABDEDB::93:95494,/5:2/./2/:;;>@>ADDCCEGBEEEEDDECEEC?>>?;>=?=AAA@<>CEAADD??CEDECEBDCGECDCEDH?@ACDEEEBA?AFEEEPPPNNMMMXWVXZ\ZYTWZWY]`]Y\]]^`b^`cb]^aa^\\]ZXXZ\WWZZWWXZPSSTOMLOTWYWRORUOQSRMJLNHGILLDFJ@?:A@2-26/057.0/1( 120(.//-7:??@3eB=V(+@.9==:9///((+++(((%$$!)+%$&$$ ( !$$%$$"'&$$&&"!$"!"$$!$! ((($ "&*($%)'%&14/../1123378<<:<<>>??CA>>AB??DFBADD??DHHEEEDFHLHJIHIIFBDGHJJHHDDCEHIGGMMNOOQRROPNQRVTQZ^b^bdhe]ac]abc_cffa`ddb``a^\\]`VWYXWVWZRPTRRMONSUWURORUOQQPKHLMHGILLDFJ@?:A@2-270/95)*0/"".4.$%133;>DBD6gE@%Y+-C/;?A=9724//11//-+&$(.*'--'%)&(&*!"$'('%%*)'')'&"&$"$&&"%$")++*$  '(!,*%&,,%+23///134444:<>>==@C@CDEEGIKCEGGECEFGHIHDBABCC@ACCFFEAAEECCGHEEHGCCEKKIJGIIJMNPMLOKKFIJLLLKJLIILNOJGLMOPRUWWSQORSTVR[ccbaiih`dhcdigcfjhcbffdbcca^^`bZ\^\[Z\^RVXUTTPSSWYWTSUYPTTTNMNQJILONGIMEB?EC507;77:40,14/)44**/:65>CHHG6gE@"Y*-A.9=;;6459+-///+((' .,)'.($$(&&&* "$%''%%*)'')'$!&$"$&$!$!"))+($ !"%%%(&'),0,))++,.//67;::::>:>ACCDGI?ACCAAACGIKKGCCCDBAAADDGC??CCAAEJEEIHDDHKKHHIEHIJKMMPQNNKLNPPPNMMNKLQLKELLMPRTWW\[\\`b_][_c_aggcehjfgikhjmkgfiifdeec``bdZ\^\ZZ[\RUWUURTVQTWWTTWZNPQRNMPRJILONGIMEB?EC507<95<6,-34,)/,,(/665>CHEG3eB=V''>)2522.//1%%(((%! $*-$&("&$$ '!$$$$$'&$&'$!!!%'($ % "%($$%%&'(''./22115747:;<>AD>ABBA??ACEGGC@>>???>@CCC>:;??<<@ECCEEA?CEEGCBECECDFJMNMNKMOQQPNMKKLLILGDABDEGHIKb`ccfifc[_^^_bfadiigfkigjmkfehhebbc`^^`b[\]][Z]^ORTVQOQTLQTTRRUYJLNOKJNQHGILLDFJ@?:A@2-290002((10&+(('+/31;>DBC/d?2%P4&G(467484550--00--0)&)..&$$*& && ( !&&&! ((&&((% (&$$$$!*'  "!!***'!%%$&)/(,*+),///(+..+,/16:;=<>?AACEFDDGHABBA?>>?>>>==<<:?<~>AC??CC??CC??EEDDDEFHIEDFKNKLLTSRSUVUTOLNMNOOQ][WWVVXY``_^]][\]cccdiigchhedec^bffbadc`dffbcfhedfdb_^_aPQRNNMQTPSUUTSTUHKKNLGJKKJIMLDFMD>8>?676/*%/()""$*//-53:;BGECEuB3&R;'H*:67464633..33..3-)*/.&$$+'$'' $* !&&&&&$,)(()(&%)&$$%%!-'" " (,)'!%$""((&/-),--00*.////1358:;::<>>>>ACBCECCACCDDDDDDBBC??EECCFC??A?<~:}?EDDDDFHIKJJPQLMRTSRSUVUTRPUTUURRZWWWZZ\[cccbbbbb_ddfejjidiidded_fhhfdhhchkmjjlkfeffca_bc[]^[\Z]^TWYZYWYZORRTRMOQNLNQKGGLFDAGA<6<:4193,.6+*(,2674C>>DKMOMEuB0!P5"C&444..,,.+&&++&&+(%%'%&$  $%&&%$$('&&'&  & "! !''&%~))$z'y'y&w'u(s(s*t*t%r's)u*v(t(t,v.x.x/z3{4|4|4|8;9<>>>>AD@BDBBABDCCCCCCCCEACGGDDGGCADC=|;z>|A}A}A}A|C}C~DFJHHMOIJNOMMMOQONQQTUWTSPTUSUUYXZ_```````^ccccffedggcbdc`dhhccffbcikihjfbabba^]^a^]^]\Y[^QSUWTTUWMOPQNJLMMHJIHADD><:><72460-5/&)2*'%(/23/>@?CGNMOEuB6'O3&F)5554-.++&""&&""&%! "!' && $$$&$$$ *)''))"&!'!!! ! "}z"}!| wu$w!vs!s!s!r!q!o!o'n'n%l'n)p)p)o)n+p.r.r1u4v6w6w7x:{>~5}8;<<<@A<>AAA@ADCCCCCCCCGCCGGDDIGDADA;z:y=|B{B{B{B{D|D|E}G~KIKNMKJOONMNPQPNTTTVWVVRSTUTWWZ\^^__``bb_dddchheijjffhhcfhhddffcbhiffhe`abba^^_b^]]\ZWZ\MQTTSQSTMOPOMHJKJIEJGC?G>7588/.44/,3/&)0.*(*/43/B@ACMNPOEuB:+T:-H2<<8860..,((,,((,)%%'% %(&&**$ &'&&&&$$$-*))*)% (%!!-'"!"" ! $}z"z%|${!v s%u%s p!qp!n m"l%i&j&j&g'i*l*l)k*j,l/n.o/q4t5u5u7w:x=z5{7}:~<<=?B?ACCCCEHHHIIIKKKIGGKKIILIED~FE>z<83=802763027:77KHMNTWYWEuB;-Q7*I/7771/.-'($$(($$(  &$$'%" (&""&"  ~~|zywus qmomhfgfbzcyax`w_v^u]u]u\u[w ]y!^|"_|"]~"]~%_&`"d%g*j+k,l.l1o4q/v1x5{7{7{8|:~>9{;}>???BDGGGIIIIIJHHJKHHKKG~G~IHD|B{G~G|G{FzG{H|I}J~K~O~K}K~NPLLOSQQQTUTS\[YWWVZ[UWZ\\]ZYabcdfghiejihgljinpnhhkkifiiffhhdjljedhhdcdfdccdf[Z\WVTVXOQTTTTTTQTTSPKLMAAADEADLE><@<757:63:6.071/,.464/GEJOQWVTEuB?/W=/L4850+(()))))(&$$!.+!&& ( "!$ %$~}{{yvronm lizhygxewbuat_r_rZoZoYnWmWlWlUk TkTm Un!WpYrYrYu]y `|*[+^.`+b*c(h+l0o1o4q7s6t7u7x7{:~9}=??>>?AGGIHHIIIA|C}C}C~DFGGM~L}J{IzGxEwEwEwDvEwGxGxHyIzJ{J{HHIJLLLLPPRSTUWXWZZ\ZWTRZYYYWWSQbcabc`bbhkkffgfbgggbfnnifjiddhifikicbefc]^^]YZ\^Z\^ZYXZXZZZWQQSUUTVVQLIN[R,6MUWKJWYMH:/ -/*4:<;=DB?CMMOMMzH@/W=-J074/)(&()+))(&$$!-'!)($!( !!!!&" ! ~$"}|}|z xvtqnj~h|h|h|ctctar`q]o\nZmYlUiUiUiThRgPfPf Oe Nf!Og Rk RkRmToWs!Zv)Z|,\-`-b+c(g.l/p4m3p5r4s6t6w:y9}:~=AAA?ACGGGGHHHIGGIJJKKLRPNL}K|J{J{J{EwEwGxHyIzJ{J{J{JLLLNNNMQQSSUUXZ\\\][XWT_\^^]\ZZfcffiffdlooljkkfllkgkprnilkfgiiglmkfeijfcedb^`ad^`c`^\^\]^_ZWWWZWVUXTQNTg]GAG>+4+!*:4/-!m]D>;4674<>DBBHEDGORQPMzH@0W;,I/74/*)'))''%$$!'"$%' %!!%%%%!!" "!!!!!$!~}zxwvvu rpn~ m| jzfwcuat`s`s[kZjYiXhUfTeQcQcMaMaL`J_I^H^G]G] D]"G_"Ia"Ib Ib!Kf!Oi"Qm&Ut+Xw*[|+^&^(c(h-k3k4m3p5r4s7u:z>~<>ABAACCEGGEGFFHJKKLMMMNRRPNL}L}L}L}GxGxHyHyIzJ{J{K|NNOPPPPOTTTTVWYZ[\\\[ZWV`babc^`]dgfighggmrrnmoniloliirrolpokinnilnlfejkhefgccbefacdb`^_^^_`[WYZ\WRUWWOQVfb`cbK/=0 44.4A70%(//,.:77>CEDEHEDGORQPMzHB0W;*G.41.*'%%%" $ &! "!   ! }|{zwurpn ml| kyhwfuesdrbp_n\lYjWiWhS`R_O^N]K[JZHWHWFWEVEVCTBTASAS?R T!?W"AY A["C]$Ga&Jd$Nk$Po%Tr%Wx&Z|"])`*f0h1j4m1o4q6t:x>{9}3!5S .I343;L>L>>?CEEEEEEFFIIIIJJJJM~L}K|J{IzIzIzIzJ{J{J{J{K|K|K|K|L}L}M~N}N}N}L|L{TR~R~R~STUWTXYY\ZVT_]``ab`^cdceeddediiffiidghheflkgilmihjhcjlkeejki`bdcca`a_ac^][\[ZZ\XTUVZWUVTRLLT/_^SJP\tN*2>\TciY+@13/:;@?>DB?CMMOMMzH?-U:*G.432/.)(&(((&%$$"'%(,+&$ !! ! !$" }{{xvt uspnnk|hyfwizfvbsap_o]kYhXdS^S^P]O\!KZ!HW ET DTCNCN@L?KDBBHEDGORQPMzH>,U:*H/22//,(&%*))'&%%%%!%()" &&%!!!"!%!}}yxvurpsqmkj|hydubscs`o\l[hXgWcR`O^JVJVIVHT DSAO>M>>ACGGGGHHHIKKKKKKKKPPNM~M~M~M~NL}L}L}L}L}L}L}L}RRRRR~Q}P{O{S}S}R{R{S|S{T|U}WZZ\]\ZY`aaddffcfggijghiilmkjmmhlljdionijnolklhbmonjjnomadhgddccdfgcb^_^\^_\ZZ\^TSTWTTV]W &Mx:,:77>CEDEHEDGORQPMzH<,U:,I////.,(%$&%%$""""! ($ $!! ! %|y|zwutsomjg|dwbv`r_q\mYj\kZiVfTbR_N]JWGTEOEODOCN@LM=<::ACECCBDEIGGKKGFJNIIMOK}L}O~O|O|O|O{O{O{M{M{R|P{P{PyPyP{P{R|JyO{P{S|V|Y{[{^zb~b^^]^_^Z]^bbdcdafiikppmrsplmolg~hvwqyjs}~V;l{۔wt^`vQL|nASFrHT$B\&Gb(Nj*Tn(Vw)Z|-`/c+c.g1n4t6w:z?>==::ACEECCDGIGGLKFGILIIMOK}L}O~O|O{O{O{M{M{M{LyP{P{PyPyPyPyP{P{O{Q|T|T|W}Z|\{\{`a^^]]``\^abdfdfchkkmsspqtqmnroicpELhHQcxEs\0l:uyO0WY<\F46O 0MA?HHA:<<>J~B>=>@CCFFCCEGKIHMMHHJLIGMOK}K|O~O{M{M{M{LyLyLyKxPyPyNyNyNyNyPyPyR}T|U}W}W}Z|[}[}__^^\^^^__cddcfdfknmpuurstrnosrkXoTJVDIKNK>ABEFFEEEHGEEJJDDGLGGLMK}K|O~M{M{LyLyLyKxKxKxPyNyNyMwMwNyNyPyT|T|U{U{V|V|W}W}^\\[[[]Z^^`aecbcfknmputqqrqnosrlQrHYJG-m@=7<>:?KOLMMEDBGIONO/P:)J3434.-&&%'|'|&{$y&{'|(~)%~%~&&'''(%%%%%%%%!$!~"}"}$z w uvsomj~hydv`s^nZjVdRaO]JZHTESDRAL?J=E;E;A7=4:4<4:08.2+/),'+))$&"% $ !                     ! & )!+$/&0)5,9/?4E8I>P"DY&I`!Lk'Rr+Yx,]*`+b.i3m7t;w<{A~?@ACBCEFCCEGFCCHHCCEKGFLMI|K|N}NyNyMxMxMxKwKwKwPyOwOwNvNvOwOwPyU{TzTzTzU{W}WWXXZ[Z[YZ\^^`b``_ekllmssnmonlnsrlOxnJ]k?GaHx!/vlE??GOKHJEBDELNPM{>~BBABDCCCCFDAAGGAADKGFJLI|J{N}O{NyNyNyMxMxMxKwPyPyOwOwOwOwPyPyXzWyWyU{V|WZZTUWXWZYY\\_^^`__eilklpplkmlkmsqm6nE7NT{U`JKtcVK\XC2kWRJMNCAAIEDKLPPRABBAACEDBBGHCBEKFFJLH{J{N}P{O{O{O{NyNyNyMxQyQyPyPyPyPyQyQy[{ZzXzV|W\^`SUWY\\[[Z^\``^`^eklklpplknllpttochWG[_ETyAX^RBJQ7 A_mbUTNA6?KGKLPRWTI;E:@7=06/4+/).)+''$$!!!                                 !&%,'/.50<4B!:J$AR%DV$Hf(Pm.Yw1^~0`1c4h5l7q9r?BA??ACC?@EEA?CKFFJLH{J{L|P{P{P{O{O{O{NyNyR{QyQyPyPyQyQyR{_|\|Z|X~Z^cbUWZ\]^^]]_^`aaa`fknkmrplloomqvup`|K\f>M;HUBQX>5]53vyl^VK?:mvL>z/ !K]VKMKMMTTVTEuB:/U9'B11/1,+)}+z*y-u*t'r%q!o!o!o!onnpppppqqpqomm l ljgdzbybw_u]qZoZiWfSbO^KYGVDRAN ,w~Ea3IVO~A{A~A@~@~=ACBDGGECCCKHJ}KL}IzM{Q~P{P{P{P{P{P{P{P{QyQyQyPwQySzTzTz^~^][ZX[ZYZ\_bb``bac`baabefhededdkopnossof^fiw`dhvI;T|P:QfbA1f[WC'RNPQWYZWEuB9*R:*D/410,+|)y,v(s)o'n%l"j h h h heegg h!i!i$jiihf~ezdycvbubu_r[nZmXjUhTd OaJWFTCR?M=I:G6@3<3:/6*2).%+"& !               $$+)0.92@ 7H"{A~>~?~{>~>~<>A?BDDB???HD|FzH|J{GxJwM{NyNyNyNyNyNyNyNySzQyQyQyQxSyTzU{]\[[ZZ\ZZ[]`bbaa__\^`^``ccca`bbbinolmpolY]Alj{~s_hbs}vsnbUiE^^YV^piE'5XtDNz}cGcG!ZjSYYz[SZZOOMOPVWYVEuB>,S>1K60--}*y+v(q"pn&l&j"h feddd_|_|`z`z`x`v`v`v_u^r]q\oZmXjWiWhTbP_L\IW!HW ETCP?K>J:G7A4?0:/6*3&/%+ '$                %$+*2/:4B!8G%>O%BV'H]'Nf'Tn'Zw+^~.d/f4i4m8q7q7s9u;w7t9x<{>}>~:~=>=?CCA>??HB{EyG{IzEwIvLyNyNyNyNyNyNyNyNySzSzSzSySyTzT{T{\\\[Z[Z]WY]_```_\\^^_````__[Z]_`innllonk]ZmjPl\fo^wcv`PRPK\u\pF\`^SJLQWfT<3/SC5K630-}-y)u(q!o%m&j$i!h feddd^y^y]x\u]s\r[o[oYnXmXkUiReRbPaO` P] LZIVFT!DP!@M >H}:~<>:~=AB?>>?HD|FzH|IzEwJwM{PyPyPyPyPyPyPyPyT|T|TzTzU{V|W}W}\[Z\Y[]\Z\^bcccb^^^aabbfcb`]\_`blopmmookh\Wiuvler`h[V\^^cqauLN\hea_YTZSOWc]WTsldXD5G\FgP-D0M^6?gEMTYOEQ^RNPQWYZWEuB>-TC7K641-}.z-u(q)o%m'i'h%g"e"d c c c^y]x\u[t[qZpYmYmViThTgPcO_L^JZJZHTERAN?J}9}<=7}>?IE}G{I}J{GyKxO{P{P{P{P{P{P{P{P{W~W}V|V|W}W}W~X~[\[Z[_`_^_bdffffcccdddhhffc`_cdgmrrnnrpll\fX~lwrgYp{w|zbbwN>VksvwtljgjtuiQ?@onWKT]rC@aIw[f(KS_dYHOeTRSS[[\ZEuB:,U:/L/0-}/z+v'rn"ih"g!f!eb|_x]v[rZqZqZqWmUkTiRgPcPc N` M] K\"IW GV DSCPAM ?I M$CT$H\$Kc$Pk(Xs.[y/b2e7i9m7o7n7q:s/q3s7v9x9x9x}>~?@~?~D}DyBxFyEwGtGtJwKwMxNyPyP{SzTyTyY{WyT{WYTUZUUWWWZZ]ZZ]adda_cbb`^\\\hhdcecefbfgefhhemidgdmnjnjmnqllhgnmbW^`b^WYZ]`a`ZVXXLNSVSLIOE;;;<22:845>@>>JVTSSVVTSQPMJMGC?3oE:,U:-L31/~/{,w(s'n"j"i$e"dd `|^w\sZqYpWnWlTjRgOeObK`J]IZHY GVETCP@N>J>J{:{<|>}>~??@~@~D}AzCxE{HyIvIvM{JzO{P{R|S}T|S{Wz\}V|W}Z[XYZXXZZZZ]\]_`cffcadccb`^^^ifeefdfedghfgkifH^t|}cXbgdgcifijmnqmmiili[\bde`\\^bddc\YY\OOTWTNJPE;<<>45:<67AB?AMWVTTWYWTYQPMNHGC3oE:.T:0J1641|/w/s)o&l&j!e$c!a|^w\sYpWmWlTiRgOeMaJ_H[GZFYCSCR@O>L|:|<|>}>~????D}Az@zG|J|HyLyQ~L|L|Q~RUUW~V}\W~X\]\Z^ZZ[Z^^`_aabdffdbdddcbb``hgfgdffhdhiggkkg^eif^NBAW]_]fr|xmtgZaebiilnrmnjkf_>e{uGbgffa^afeffca]^[RRVXTPLRG<<<>47<>8:CDCCNYWVVY[WV[WQQOOHE3oE<-S7-K24~2}1y1v.r*m&j$i%`|"_|^w![sYpUkTjQh Oe NbK`I\ EYCTCTAP>L=KM"AT$E]$Kc(Rl)Vp&[y+^|0c3h0i3k2n4o0r2t6w9x9x9x;z<{8z9{:|>}>~>~>~>~@|8:CDCCNYVTVWYWV]ZVQSONK3oEL|;w;wA{D|FzH|NJ~K~MPUUWW\XY^]Z\a\[][\_]_`^^`ccb^````bbbbeecccbdeaefdehgdeksyxywvpmibbhlpf_enrs{ehkolmjigg`gja`Wdfeb]]bg`b`_[YYYRPSTPJIOD88;;12:<67ABAAMVTSTVWVS\YWTQQMJ3oE>.S:0K0-v/t/s,o&j%h"e%b&\v%[s"Wp Tk!Ph Nd Kb I_"GY$EW CT ?P>L:J8E7E4@4<2;/8.5+0'/&.'."* &"         ^Uj|ui}tlb]sѶoukA:I   ! &$+*3 /83< 6B"/T9.J/~/t/s.p*m'i$g'c%b&Zr$Yq&Vm"Rj"Ne Kb!I^ F\"AS!@R ?O>>?67>>8:CDCCNWTSTWWVT`]\YZWQO3oEA-R7.L~4~/t.r.p*m'i)f'c%b$Yq'Wp%Ul"Ph!Md"J_ F\ E[ ?O >N|CED|F~JKLOSVYY\_Z\`c`af^_]^^]^\b_]]_`_^`bbcefggfddbdbdebfgefhhe}vpfc^QUYdkikmrgpiYen]nqsvqpkl\eukZYdzjmnniehndfgd]\[`WVVTPJJRLAADD:N$BS'EY&L`)Pc)Xo,[t0_z/`1c1d5g5i+d/h0l1m/n.p/r2t6q8s8v:w7v7w8z:|7~9}:~AEJLPKKMOQSTU\]\^\^aca`^Z][ZZ^_]^_`^\ZYYZ]ZZWbcbdbebbVaje\UZgdgfcbijf^bccdhjgigecfhmpoppkifhhhjhieefibfefddcdb`c\ZYX[VLLNPHHMCA>A@2-':33?HBBDGEDJPPTRZYSTQQMJ3oEL)CJ&}*|Bu,o(l'h'd(a(]z"Zt!Tp!Qg NdG]CWAS>L:G6D2=0<09,5*2&/$+"*& %!         iUjwęmzseb࿟lNnJ-PjNtx^xxlݿȤɧϰƞF8M    $%))/,3 0;!6@%:G&?O%CT'H[(Ma,Re)Xo-[r0_x1b~1c2e5g5i/h1j1m2n0o/q0s3u7r4s7u6w7w8z;}:9;>AGILNMNPRTUWX^^\^_\_`ba^]^^]Zd`]^``bbb`^]bbc`eededhghnrpa_NCJcgfbcehccgjhknnjkkiiinorssrqkijldgkiiffjhjmlgfgifgea[[\cYUSWQIINKHGKF<6:C??IMLJKGDBJPPTR\ZTVSSMK3oEJ)AH|'x(y?q,o+k)g(b)`~&\x"Vq Rk!Md I_DW@RN    $$')/,3 2<"7A'n-m*j)f(a*^|&Yt$Tm!Oi"K`!G]AV=O:J7E3?/;,5+4)0&/"* $"!          UAZqrzأСuvύƆkl糣nipf^icKlϾ`Sdtcu    "$''/+2!3="7A(ACCEGGGMNOQSVXXZZZ[\^ZX_]]^_d``b][X]^``ec^``cef]`bffhbangey]`_`^bb]^dgdhjkffdghhiiikmlljilpdekhiffgknonikkmcfhf^\Z[[WSWQIGLNJIKD?>EKDDORPOUIGELRTZW]ZVVSSNK3oEM)>zCur s:j*l+h(b)`~'\y$Ws"Rl"Nf$H\"DY?R:K 7H4B0<.6*2)0'/"*!%!         4";r~{̕ԛ~cym͘–~DȍǩՄoiRr.3D*Hðǜ%,:gWmn$%  "$''/+2 2<"7A'C;4/6C??IMLJKDB@JPPWUYVRROOJG3oEL)>w@sn pO6[ȭdzXNj uf~ĩԳν^K[  ""&'/+2 2?DEB?>JKMPRUXYXTPQV\ZWda]\__]\XWZ[`bed^^Z]`c_^]]]^`cbem[VwW[XVV_``\^`\]bfdcbb`cimobcbb`bcggffc```ccdebbaddWZ\YPKILKF@GD?8>C=896*+':33?HBBDDB@JPRWUZWSSPPKH3oEL)>v@rmn:f&c&` ]z%[w$Wr$Tm"Nf Ib$CW ?S:K5E3A/;+5'2%.$* ' "      {xȎ˔Έl•u(zcqdZW,$?VQ=jpIuү؛THn/UJcsүƐy    !"&&.+2 0;!6@%:G&?O%CT'H[(Ma,Re$Uf'Xk+[p+^t+^w,`|/c/d+d+d&c!_\]_a"j,q0y9=?>?DDEE?:72NPRTXZ\^YQKMVZ\Udb_]]\XUNNRWZ`^]LMNTY^^^[XRRRZ]aq\UqSYWUU_a`WYUPT\a`^\ZY^bimW[_^`afifgfb_Z_a^`__Y\^aYXSNGFHMD:=<>57M8E4A0</8+4)2 %% "          W5YvNjژÊТW3'lgrgQiefBc6琏d{QUkקĊ^T<\Q>avs/%0   ! "*"/6 /9"3<(:E(?K)CT(GW*K^.Na'Sg(Vl.Zq-\u/^y._|1b1d q!Ys}Ei:w$!I6GLNWž뀶J/RUbuD[ݛZnQh\SLBUZֽvF>I@bK"hR>wxGVnPYq]8O|NU_Z_\lHjI>Xl:`*VdB;u=:'!PHfRiMHGGKKHE/h> Sm>t-v.q1i*cf|,^|'Zx%Tr$Pm&Lh'Hc'D_$C[!?N:H5B2</:,5)2&/ " "         WI^snlsNJk:BA)`LG^Yhcz}lmUqbʁ؞̜VbMkYIjnvĥj^k    !%,!/5 /8"3<(:E(?K(BS(GW*K^.Na'Sg(Vj,Yo-\s/]x._|/`1df|PkU7L35NJ[caCޱJ`[QYjٶew9D^^zd`?cPVRl``ZpC{zj.NfD70uD Qk:q)s*n/f(`bx&Yw&Us$Ol$Kf$Hb$D^"AY >T"{Y/ƊVPD'h&_KPshw;Ziړ\4RڈXGh^ZTmIXJgI>:sKy5XE]D[KGEEGGEA,g> Oi7o&p(h/`'\ ]r&Vq"Rn!Lg"Ha$D^"AW >T:N8E5@/;.5*3'/"+ %          G4O§{s\"-AZE!Hfv4bknbSN0C1VUHIe:UDZʃټ殽rQ>_8,N2%J.!2  &)/+2 /8"3<'8D'>J(BS'EW)J]-M`'Rd&Vg,Ym-\q/]v,^y/`0c9q WqoҹG}+TQ{4rUCDpYWW싶GMAZPNq*nTN\ZWRgaTfvBiIC5kZ~A\GW6PRMIIKKGE(e< Ji5m%m&d.](W!Zo&Sm$Oj"Jc"E^ CW ?S >Mb]PR?qdړevP>nIw`rpuaa(k;CBqΘingXx 2^ImpddUk    &)/+2.6!2;&7B'>J'AR'EW)J]-M`'Rb&Vg+Xl-\q-\s+^w.`|/c.`$WrpN!:J6G4<0:.6+3'/"*%         >0Hʣɲ͑vxhHkNxeZbPB>Mgl^A;|{fkUQnLі[dMV7T/RQvM/VyccUu{omcQl    ! %&. ,3.6!2;&7B'>J'AR'DV(I\+L_&Qa%Ud+Yj.\o-]r+^v.`|/c~7\)\ym\t?%pf{xN\գ|.Py_HAE+A+I9"J?Ta]XQg7X5@b k0)<A\ET/MIDAAAA>:$c9 Ji3k"i$az1X+S$Vk%Nf$Kc"E\AV ?O^AxӻmuOvtY~eTt|ʭƦƞ|l  $""*!/5.6!0:&7B'6&u7~>1݀1\U{{+SzIDA0I3K:Ha_UIh@A7\v7=P<[DW;TGB???>:7$b9 Ji3k$i'`y/W.R~%Th%Ld"J_ CW?R I3i;Ox^R0YG0Tp\zx %)   %  '"/6,5!0:&7B'E&L?Gag[Kqz>00TZ 3WBYR!:L!7H2A/=+4'0!)%           5pاoĥj\`=3guELIY-]Uޓ1ds\WbXwno`[wQrrj`ሙitNyZyy_tIAW   !.)0 )3!.9%4B):J'?O(BT(EZ*H^-M`/Pb.Tg/Vk/Xo-\s3az4d+m']zs%h|L26?C&>SL&AS'EW*H\*K^-M`,Re.Uj/Wn-[r2`y1c"b*`z{3wH*pMQПY@ڕYVoNOoI?}wUZTnپn?;\\hܢ[9Hh'D}*>r'H1M2SNHD=EGLM:k+A_)] ]z(Wn.My'Ir!M\ AY?T:M5G3D.<)5%/%/!+$!           ;,Lsaެ̗ikjpK|qBuoiD4WU$VMTEPl:C^'Y Yu&Uk1Lw'Hm"KY$?T

I&CR(HW(I\+L_,Re.Uj/Xo/]t4b|7f*e$\vp5bcCOiitrOAewaD;LTSQYEODVkZG@<706JrT^?"6^vrgH"?R!:K5E0@/;*4$/ )' $       !NIkƴkmVP7lso|_s}mDXa/J?ozEG\PSebEKTbUWF֏ƠѿS|Zsyr|`Wl  !& !)++/ /6!4< 8A$>I&CR)HV)J]-M`,Re/Vk1Yp/^u5c|7g kMRCM+I1M0QIKQXZXQMAn:7UjPo!Ww&Pj+I_(G_$E`%@HNTRTWY]]]^bZ[^_UUWVVTWWXTVYVVZ^]ZWfb\Y\^acZyW}S|Z`_\}Y{Y{\~_`cffhff___cdcdefbX]_Z]addab``]aci`dffb[[ZSUWYYZ^`WXZTSSTXXQSRNA>CPIMOM>?KKDDKKDDK\K33XT(4Pc]VRSY[\Zkc]4RgNm Tt%Lg(E\%C\ C]"s4m9rE|IGHORNIGQRVWZ\\Z[XY[\TQTTRSTUVSOVTTWXZWUc_X[Z^\[ٗҐЅΓFhYP|MxZ|Y{WyUwUxWyY{Z|\`ababZZZ`cbcb`ZW\^XW]bb`^^[[]ad\`cb[WVYORTUTUWZTVSSPQRTMLNKH=:AIADHD::?B<Z!DJROHKPQUWYY[Z\[YW\WRRTUSPSVTTPUSSTW\WV__\]\^ZWa~SsEgWyDkZPyEpUwTwSvTvTvTvTwTwW|\|]~`__ZZ\beeeb^VZ_`[Y^``][\ZZ\`d\^`][WWUPSTTSSTVTSTQQORQLHGIE?>HF>AC@47>@;;@@;;@YM?3'&(9<1$!+@PZSOKNW[]Zf`Y4MaFfKk C^&?T >T=W!:K!6I4E/=+6'/%."*        CAWtfaOOS"igyirsfkYXTGZЉu}k`Nqlfx^fYl !$$)),,3 06!4<$:D)?I,CM+FW+K\0Qc/Wj0\p3bw6h:j={>|??BCGLEEJRQNNTWV[\^_\^^[WZZRRTUTRVVVVTQTTWYYYXc^[\\\^\Z_ZK}ULsLpSvHmJnLpOsRuTwVyWzV|Z|^acfbbilkeeeeabdf`[]_\^^`^\]\^\^\\XYWWVYYYVUVWSTVSSPPTKIIPMINVIBEHE<H,BL+FW+K\0Qc/Wj1]q4cx6h:l8t;v;|?ADKPJEGNPOIMTVY\]Z[ZWTTXTOMPQPPPTSPLNNKSWVUQ^ZXVZ\[]\ZNGzTPwKoLnChChEjGlJpNrRuTwSyWzZ|_cdbcijgb`bda^`d\Z\ZXZ\\]YYY\ZVYTQRRVTUVUTSTUQRQQMKORGFINLGJSE>ADA7:CE@@EE@@E'-C\iifcPTV[TL>7ZWUX[^``c^Z5K]C_Fd>V&:M":L:O4E3A/;+4'/$*"&!"        tmF7W  C:f:;@:]wvq4_|V6GKTkyg:ZQcbdnZMbJ\fb\Ysrԃpk\zgT:}{zi^~M@eovfMvuTF[ ! !&&**0/5 3;"8B(>H,BL+FW+K\0Qc2Xk1]q4cx7i?>47>D??DD??DE>?NWVZ_I@>>FKIE]YWV[__`a\Y4J\C^EcH+AK+FW+K\0Qc2Xk1]q5dy7iRA^ Dc:P,?N$8H!:K2;/9,5*2'."* "        tlC>[94J!0)RMdyy]hȌtrq\K*IKD'RfraR\Q\Wc/>N_\}fc|NSYPω^pX:i~TLi%=~{se .'$!''/,32: 8A&?H)CL(EP,KY/Tb2[k4_s3d|{BIJIIQTWUWYXSUZ[[\`ZVT^[WVZXRPSQQQQPNMLQNMMRONKWWZ]``a\[YTS|TwPtLpGlIlEiBf>b?cDhKnNqPwT|Z^]^b`bfjfgjhfbhgb\[[TX]`YXY[YUX[ZTTTWPQSSQQTWHINLFEIOKEFA>ACKJHDD@>DO_PNMKKNZM||MM{zETI<:ANW\TTX^efc^`a_):M=ZA]6L):H 4D5G0:.6+4)0&,!)!         )WToA9c>rkG@`( C?9Y%X]s* =C)RY\*UP9(\QXBQh^afcERgbn\dPA[BpF x\ԃYr*3ZRiyrgQKfK:`z]}iq\Xi  "$!''/,32: 8A&?H)CL(ET+M\0Ud4\n2av4h~;q?w;{@EEHIPTWTWYWQVZ\\\`]TU\[VTXWPOSQQQQPNLLONLLKOKJUVZ^ba][[ZWUT|SvMqDlHjEiCgAeBfDhIkKmNvS{W\_^ab]egebfed`dd`Z[ZUW]\YVWZWVY[VUQRPNQQQQQTXEIMJECCIHE?;78CHJB<>>:?IXTX\]TMN/QR3/ON'EEJNQUVYWTX_egc``a\):M=WA]5I(:G4@4E/8,5*3'/&,!)!         /NKehcvpТbVTItla ;5*Tula}}hXBlb_opŁ$RE>\hHH\FNi_N^nVoviFi2W7hVnܱʁho* q~u7/L 0~u`rql    $!''/,32: 8A&?H)CL'HW(N\/Wg1^o1cx7h8rAw:{?EEGHLQUTUYYSVZ\\^`ZTU[ZUTWUONQRRTRQONLLKLLOKLJTU\^bb`\YXWYYSzJsEnHjGjEiDhDhGiHjJlNvRzU~Z\^bc\cecbffb^cd_Z\]YVY[TTW[ZVWZWRQLMLMPOOPTWJOMJE?CGJD?<9;AKID>@7:?IADR`dYH?NAAPP?>K'6JQTRLKYXZ`dga\`]]+AIIINQZSTTYXUU[^Y]\ZSQX\XWYXRQTUVVUURQOLNKOOOKLWXY`cc`[[YYZ[V|LuEpHjHjEiDhDhFhGiGiLuPyT|WX\ac[bgeffhe`dd_Z\^\RXZUTVZXYZ[ZSPNNNPQPPPTXNQTLHDDEGH?<89EJGA><<4W@Z6G'8D2;3@,5*3&/%.$* '         +b^yỊ̃ıµ߰ϢĨˑxjSGtk]ws|fbCjrlb-12<7=:?:45VkUmWxgkd "$!''/,32: 8A&?H)CL$IY'Qa.[l2av3f4n>wA}4.6AIC>::6-3?OH:6AZz_&'__&"[pC4FPKHJRUSOG[YY(:G;R=V2A"5=.5/9*3'0%/$,") &          OMa͢ȮϭŲĺϦ~fUȟ{\HZMzgK5g"@q\̧ȮudԐ|SIcVi~gQiꬵςi{ !5"NvQq TEdEAY*'@<2T^Ktydpmh! !+$!''/,32: 8A&?H)CL$K\'Rb.Zn.`v4g4n;xB~CHMRRT\`VRVXUOSVWWWZTHILWQPSQMJNQRRQQNMJJGFGKLIEQQPRUWZ[_\[[\WQ}KwVxSuPrLpKnKnNoPqIuKwPySyVy[{a~e[`ccbhgeadb\UXZVIOMJGJPRQQTQMJLKOOOLIGILPTSL?7;>HD<2-4>HA<86,+/>k]KENvqqonb0"CanIIJLPPHB]ZU*:H:O:N.8&2:.5/<+3*2'."* %!       ce¬Ҩǟƥ̫ңƖ~ǼͽͩķѕcJw) 6߼պ·ocډGʽis5\Ћδٞ|YCf'8)o}jxe;8O䜕}wXTl2QE|a\r  , "%*+2 094=":E(CP+IW)Nb.Uj2^t4f|4m7v?C=BKORRTYOSX_`Z_bYVYZZSQQ]URUVPLNRLLRSOLNTOMKKJIHa\X\beghfc][ZTT}PyQyTvRsRoRoQrRtNwUT~T}U}U}U}Z_\`cbbhjiV^fbb\UJOTQQP[[ZNPRRNNPRTTVQRQTWMONKG??@<@EE@>>@C6GFGBEFJGE/g)*:H:O:N.8&2:.5/<*2)0&,"* $!       *{|ŞġĚƯׯװ׹ٽٻұƧ}lmZ<(W.I۪ɽ͚ϋң{`P^ZR7.m۴bvD2W 3XIok["ʙ<.+%@=:TRF|GCW '. "&+,3 094=">>:>@@>:<>>>@KKKKPTgERuQ{f_M<,DDABBHIFD2g)*:H8N:M.8&09.5/<)0'/%+!) $!       ΠȠĚ̻཰޵ЫƞzpfzsvdfTўӖƀԓز͹ϙ~ܶjn;VfҕۨNpW8kT7gyhwj^T|/'R 0؟+JH^{wo/%"'),.43; 6B$>K(EV.L\)Th.Zn4cx6j7r<{?FAINTTSY]SRW\^Z[^SQSWWLKLTMJNNHEFJCCJLHEFQLLJJIKI\XSV[``]b_ZYWVTRzPyQxUuXuXuVvSyPyS|U~WWX\be[`c]^dhiZbda_\UMJNPLOSWSILNLJIJNKKPNMOQQGJJFD><<6:>>:8:GqI~nm[Q2T8,?DCAGMKID4j+)8G8N:M.8&09.5/<'/&/%+!) $!         ^`uȫћkhbg±إȠ̥Ljjgvqʉ~|دȲȎيܪȻζЕĩۣێОdeϯٮҭϪqrSUkvwXW:ny`uk\ZPwTLq /;7WUQqӄ!'$>>6:>><:<>DADNONLVOe?NtHwx%IY<-E@@FIMQKD7k.)8G8N8L,6&09,4/;'/&/%+!) $!          "4}}ݡĔ}z{ɫӪ̨ɩΚņ~ffwuwpyǦǬϳtzɗ٪ԵֹϽʼפ¶{\cGp]Qv}utjrXrL7mn\laMFm,&M$@6))+kde^fb~CCR !&%,,43;!7D">6:>@><>@GCKRTTTWTkO]|Gkr(T`<K$CT)N^0Uf-`v2g|7p:x8~;AFJNWWVX\^ZV\__WW]XUX[]SQRVOLNNJGIKGGLQMKMMKNOSVTSc_^^bd^]b]\Y[[ZYTWY\}\}X~TSX`b\[`b]^deb_ccbadc]W[\ZLLPLNQSMJNPNLJLPEKLPMOOTLLMIE><<6:>@>>@CNIKT[VW\TmO]y8S>LW]<<>@MIMRYWVZWiKWs1H'\ChYU,?fEEAGHNLMBp1)7E7M8L+5%/8+3.:*2)0'.%,"'!& " !         47Nͤʕvz˾ŸꑄZO."Rkcfaҟ ij˓xıˡrvuviçѪ̡dTx/)Q0*Rxje`M[2GkiqROrKEp|aUnyg =8[MJj|wy6BCVruEKP  "%,*2/9 6B"CHHOWXWY[`TUW[VQRXPMORRIGGOHBFG@=?B==EHECFHHLQUVTT^[WZ^^XR`_\^\_`]]_\ZX~WWTT_b\\fha\digfhd^chcZUX\^DKKKHMJFGIJJGGIJACFKLIMMLLLF?742/48:88:>KIKWVUUY[lLZy:[DyFPL[T3cE??AEMKJCq3%5? >H3@ 2A )8/6.0)/'/&.%,!* )'&        IMe٤ٛy|§Ω׏wt}{{sh_~Ҟ˚vm|̗vyv{®gTC5g~^M~o__LNrgOr^{myƿeXq =|vPN`amqDLn`e56P .5/5!4<":D%?L$CT%L`-Wk2^t/h3o:x?@DMQOVY^[Z^`\X[^\UV[WTRWTNJPKGHNMLLRQNNPMLJBJLJQVXYWfdccddc`c`_```^ZZYWWVWWY^``^`cf_bgkhdedbU^\ZWVWRJORPQNRSMNPMHFFHBDEDB?BERNKH=56;+/77>>DHHGO_cdfn_ZY]]YZ_YPPTRGGH?>BGOSPREEEKRROL%d,%5? >H3@ 2A )8/6.0'/'/&.$+!* '&%         4ӒĉĈűآ҃daJHzqi~vĖ̛ˆtk|s|uxsvɴȲűʛu_naysxgvvdn}{z}ŽΧ`VueZĔ^_]bw~rw:=T  ,4/5!4<":D&?M$CT%L`-Wk2^t/h3o:x?@DMQMTX\ZW]^ZVYZYRSWSOPRMIGJIDDKJLHMNNNNNMJGMMQVY\ZXcb```bb^b`^``a_\cba___``^cbabgfb_fkfefdbZ`_ZWWWTIKPNOLPOOQSPMIKMEHJJGEGHLMK@=24:)+66<@BEHEM]_cfi]WWZZWW]YPPOOECH><@ENQOLEDBGNMLH%d,%5? >H3@ 2A )8/6.0&.&.%,"* '&$$         \b~~ųݚˆwtYVph~v~v~w{swqil_rdvĬ²ƪƫܴdzŶʪğ̢|ģħĸќtyrwƘ\^s  *4/5!4<":D&?M$CT%L`/Xl3_u/h4p;y@ADMPLSWZWV[\XTWWUOPTRKLNNEEHDC?IKGHJOMLKMMKHTTTWY\ZXb`\\]__]__\_`ba`geda``_`affbaghg^fgecbc`XZZTMRQSHKLLJJKNEGHEB?@D=AEECAAAHJHC=478,04H3@ 2A )8/6.0&.%,$+!)&$"!        [aʋ|x}z~֛LjojZTyrvnob}lѾпιôǻᲧ͏h]~~|yxȯ֨͠ §ƝКƳӂ  &0/4!4<$|DDGNQLSWZWUZZWTTUTMMQQOPPNJDGG@DILJGORRPPVTRQVUU[\\\Zc`\\\__^^\Z^_ccbggedba``bfcabhgf[bcb^_`\XZYQJLOLGILJJIMJCGGEB?BD=AFFDA@@HDGD<7;:.2H3@ 2A )8/6.0&.%,$+!)&$!        2–‰̐jhURml䱬ݒ~jemhxo|ɳҮȦɲĺ¸ةzc\Dž}}~šƔĮɡįĥĺڸz|   %//4!4<$FDEB%d,%5? >H3@ 2A )8/6.0'/&.$+!)&$!        =AWѐ|xLJ`^kk02U<;iŽȭװ֟Ė•˘zϯӥɽ¹Գ̙}{zsvst{z~Ľ֩խڻٌ=AR )*&3/4!4<$ADA>>?D9>ACABDE;H3@ 2A )8/6.0)/'/%,"*&$!        AEbnrsv|șǙϤgdxwҕ€~vuMNq544`ǬҪЪӜnj¢̏_Zzt~a`KK~^cy|x{Ÿͣvz{ipvz~~{ڴǰ»Ϯ՝NRj +,'4/4!4<$@@<AGGLMSTZWW][TSW\VVYYVV\_[Z[[SNRQOMJE@:5>868@CDB%d,%5? >H3@ 2A )8/6.0*0)/&."* '$!         ?Ccsutv~ģћӁhdmjnm:E2:>?BBEGG%CP$IY"Rd.\o1cx5o>vCIIJPTLQUUSRQWVUTUPEHLRNNOOJHNUPRUZVX[YWUWZ_]^bZVYZWWZcdfdcf`Yedbdecb``bcccb``cigegjgd^a_[Z^]WKMOHJOQHBDGEEGJOADGA::4737:;;AEN<@DGKJOPJKNMKKNOWSSWWSSWNKOSYTW[^WW[ZUUXTK?71/.1?:9:=>>> X,:?%8?$G%CP$IY'Rd.\o4cx7k:sC|EEHMSMRWUTSSXYVTUQLHLTNNRTOKOXRQW\XYZYXTZ\^^]b[Z^```cegidefe^ieedhggfeeeeeeddeikiijid[``\Y\[XLMPJNSUNDGHGEGJMCDGA?:<:77<<>>GL@DHMNNPTMNRRNNRTYTTYYTTYOLPT[VX]c\Z_]VVYQM@731.2;6348;:7 X,:?%8?$G&CP&IY'Rd/[o4cx4h7p?yBBILTLRXXURVWUUVTPIEMRMLQQMMQTMPTXVVXZWWW]_a^e_]`cb`cbdcbbea]igfdehgggffddfffcfifghdbWYZTVWWULMNHMSWQIKMKHHKNDHB@<6:<:::;7K %< ?CDd"IDa}v~}MQg37S).SBGqtztyʤ{Xhy8H^*4S'.GV^|{xs~lq $&!'$+)3 06!6?&>G&CP&IY(Pc.Zn4aw2g|8m>vA~DFMSHOVVTSSYTPRTPGEGRMLSQPPTRLJQVRTU[ZWZ]a``ga^`a^[\^`b^bdbZieb`begfcb``abce^dfc`d^\PWVRNQQOMNOGIOTMFHHFCCEHDAD<:7989;;967?B<@DGKJOPHJMMKJMNPLLPPLLPMHKOVQUZ^XUWPIIHC:/!!'..-(&&.020 X,:?':@$H(CP'GW(Pc1Zn4`v2g|;l=u>|DGNTKOWWTSUYSSUZRHEKSNRTVSVYVONTUWWZZZZZ_``ad^^ab^\^_bbaafb]ig``bfff_____`bb^dda_a`XTVVPQSSMSTRJJNRIIJJIFFIJBEDC<<;<A<@DGKJOPGJKKJJKNNJJNNJJNNJLRWTW\bXUVMC>C>3$$$'..-(&)0442 X,:?':@%H(CP(GW)Pc2Xm7_v4f|:k?s?y@CKPKSW\YWZ]XUY\WPJOTSTY[X\`WVTZ\[Y[^\Z\^`abWTU[`^]_]`^]^`^WgeccffhdXYZ]\^\\adgdba_WY^\XTUTQWXXOORRHMOOMLLOSKGJGE?BEDACA?>@E@DHMNNPTJMNNMMNRMGGMMGGMTMPY]X\ad`XYRAq?w>|CINJOUWVTXYVWW[VMGLTSSY^YZ`ZTTY^Z\]][\]^abcTPR\`_^a]cb__a\UfebdfhcbXZ_bcb`^`fgd`b`YZ_^XWWWOPQVOOQOEIKLKIKMQEIGGCD?BADBC?<:?@DHMNNPTJMNNMKNOKEEKKEEKRLOW\VZ`f`WTM<6>R  $&/ ./,,$29(7A,=;<==C?;741<@DGKJOPGHKJHHJMC>>CC>>CKEKPVQSYc]TPG9+,%$'$+++ X/<@%7@":D!7D!:B.5"3:*/*/*/)/'.'.&,&,%,"+ )%"          /8@~stw}am?KrȏȑӠЗ§ȵؘǝѓǑȧϤϗňˋ΀4XWuu&:w<@EIrkHU͂|Xewr?{~JIROf\jhfMh\~@7NoZLZo`fexg`[_V^VEN^YIluhgՄ]gvujfgztsP/RW]zွbw`nocxb`;[Th[nt};FWgR[dJH\=GP/*KIO !")*0+2!4:":?'?G)CL)GR+M\1Ve7]k:cw?i~EqAs;u<{BL>>+OK2S7S!&<(N>5/TWUemn^[S^siqnbAmLb\44RP:kYNҡTEWHPJWLdYtjiYMh]fTT{i]PHG&>G":E%?_  +ћӉmr !:!'?LQY!!/XWv //Sڱ؇%/: "$*+2 ,328$6<(licK1[2!ccMZnliE ErV\T,W6WZCbQ\ecE?.~z|Zhh\ay<)M7LnXc*'' "$"P6DG-?I'?H":E&>G2:%5< 06 06/5/4.3,2+0+0&.%,"* '%"!          lnadqvbk0=kkury̋͘΋̓hudpq||ƆʒՃy}ɋʃzTT| ?B_ᔛ||9>L浸RWa./?WWx >΄) $$*+2 ,3 /6"5;%:D'?H'BM(GW/P`3Wf:j|0cs'\o8jRJCa   $) Mi`u 8Tq *) XkoъTUoL  s9M|  $G.& @Hpmbxz(   %Dx+ <^Hs$C_`y`Z}  *BLx$ Xn $ZeoNPZe3bi`W%fK*& QdEznmo 2Es DP! 'ec!,4 "$**0*0 /5"3:':B(k%~b;b; 'cwhSx%5?ӊofuSfdڋ ?  )dtgp肶T3xWc]\:KLkQB~Wq|&5H4knW tH  P:HK4GP*CL$:G(AJ$6?(7?!4:!4:28 06/4.3,2+0)/'.%,$+!) &%$         +hix~pwhp]g7AwozϟΆx͛ݙѡ̬ᚡ͖ɣّ֤ɀ}p{p{jvdojvx}xHEVTMPf&*2./A^]{ek x䬲6>N./P!$"M{y͌nt "")*0*0!/5"3:(8B(LO9LV-FO'>J,EN':B*:B"5;!4: 39 06/4.3+0+0+/)/'.$+"* ' &&         42KSTv|^dSZS]ny짵щĜ܇{uvCEeHKh`d~ps™֛؍w}tz}msheSI!!=56W||pvQXv  !ئMTh"0xz.srްՕHOu   %%++2+2"/6&4;(8B*P AFAf[)aGAsR+QqMsLJG7.R_V mqvC\KO^,d,EKJxsce?V|Xct \w\JS_m(q RkfVOE/AZ3Tu |jtMn LvUNaiyPJlvOK|QJPYT:~[Mz}$!OP4SRIciaZChnta_ qD-ekiQ:7$PBOSZ%/A}ck?D^515=ԢġEMo ! &&, ,3 .4$/6&4;):D*p9t9z?Q/YWY"C64iN KYt?%g挺Uo!/=U{XZ\{e3cbq8߈琰T_\Tك?NykszvkfWWt^dn rՀZdJWjWai`udDvPf~8San{0Dhj77COWKvST!.9!_fsz+dhRSHpiwyP_LhpK!7< 6;5:3805/4/4/4+/+/*.),'+%)"&!%             :Ąxk|׋wzo|^j|ԝ/0M  ad}iquyrtROsp|z/+? IQhU`~X`~U[w +:K}wZb ! .9W֜nv   !"'%)&.)/ /3 25$6<":B&?H(DS+KY/P_.Sf2Yl:bvsAzGX2RdcJRMa=Y]Joq\RJt0lZzi<,)m]OOcXJ͇"YdvtAx+TZSN{2E,p@WlcVhCLse`Ntl{MymnleSpb&Sq{biasSu"I[g/pD]W'n|cdbcSWB?`''6rh=IMUidy=93be)8sSfg~AcITWeSM?p$f kK6!K+'& LGY`+Ra(Ta/MT3EJ)?H'AR":?!8= 6;4926050505.0.0.0,/*.'+%)$'!"!"                 HRmxfqwѐ}t]lcn̖ʈ&&B2{mrcgxyvsSP&"F jqXbfltzAHf %3HĚ)4\  >r{~ah| !$%*),*0,3 04!36$6<$p>vD}FE"QiN8PS_Gr!Ua:qGA 0S L~cTMO_K?z*[f}];`\RT}0H )2_%]rUWgJS aŌ"hĎcRw\l`$Poyblil^}Ad6Itxd!<`Oa%k|becf4 Rie:DhDPQN{  PWU[Jkft\lexxJ^OiQnQv gW~X<$9!/.*"LJ\e0Xf,Wd1PY4JP,CM'DT%:D$:B"7@ 5=3;2:0909 06 06/5/4.3+0)/'.&*%)"& $          6?R¥לgqŜEj34T/is̔ȌUZn  !$$)'+*0,3 25"48%7=$E$pUYٔ}ğPSi   %%)'/+2 25$59%8?%y0Uf { Ng5qnKRu!=3qx*i>q[RnWWYJZbhwkjV$DnverccVs!4Nct ?iplYp!YZ-bcc`b74yoaf9OKr:JF́  &.}g;K~ FT_/cYHeyc?sjbZe+.sRO](/?JG",'% IQiq;gx4ar5Ze>U^7P\.Na*FR*EP'BM&?K$Eg mrn[JiHa.`he__ZR0 ng/7/ARDD,2`'g@RS[VRb|xccyZC~hlnyw ^EWA|X]45QW(2/)!HRit?j|2ct7[f?Wa9R`+Qb-HT,GS*DO'BM&?J$H @H\{_VT[Wq")]τfz^|~J%K$I"U M4 "!=5{y!q. )EY.Uu$0EIdki^_t" %' %9iu2 [/&;$Wgvpkmnjnv(9R*IA.qAu3 A,$B/"&<".A$' '?!<&_udKF^3@$>GBK ]``?H4RO9E ?L0:!T] '8.<)%2+D%$%'+DS ۦ EM lD/5tW;G$?8:0( IWq|Et9m;fsCfqI$s>jwEku>eu3ax/Yk.Vf(Rb)N^&L\)KZ'IW(DS(EV'DT%CS%BO"@K!?I H*BN(EV*K\/Te6Zk;fs:et7ev2g|7m=tC{C~c%CacX^SH40b`O4p2$7Y^\cgMO[dS1ClavbccWUQWcSO_YTIOR`KHQL`nanm_\tZWd^otwbz~bqgf~sg|e|j|ohhhkjilnzkgmi^cuQEVjbW_f`7Te,LhS,%TRV/[|EKL'W<6]/T1E&W?)cVNERXlXVM(6+J<;4($ JXwL}?yBo~ImzAhz4f|0]n,Zk*Ue'Rb(P_(M]&JY$HW'GW'EW%DT"CR!@M ?I>H=G7@7@5=3:/8.3,2+/)0)0&,"* %" "&                 KUi|P\n         !$%**..4 /6 3;"8A(?I*DO(GW+L]0Vg6\l/_k-]k0cs=oK>H8D8D6?4<29/6/3,2*2*2'.$+!& $  '+              $isxt8ER            "  $&&++/ /5!29 5=$:B(AJ(EP'IW)N^/Xh8^n/br0cs7h|;l2g,b7oN; Mf?.5-@h*Jt|f[`jaURMLOLOK=Hl?OQYTcJVqc^i^LSk \NMHB37-,$MVyPEEvLsDm:j1dw/bt.]n*Zk)Xg*Ue'R`%P^(M_&L^&JZ$GW"ET COAM@L:H]              !%'',.0!08$4; 7?%,ZHDDTB$FA>74,(OU4O~S|0x1wJn7i|2gy/cv.`s/_r.\o+Xl&Ui'Nb%L`%K_&J\'H['EW%CT!?O >M >>>75973+/)'SW9SW4{5zMq>n:k6h|3fx1dw3at/^q.Zn)Th'Rd'Nb%N_&L^'HY%DV"AS!AP!?O M"ACNIINNIINXSU^cbgmpjhhdXUTHC@>??:1<:712/+ S\AX[:M D??DD??DMJPY[\`hc`^]YJEI><9711'':75-/)'S\HXZ>AU}C}By>v>rM Wg*4AqLr@j>r9w*o)p7z<{c*=Gvg:G9Z?d72] e}YZYWYY[\[YH:rL?`js]h+[`fk|t]cq+=p Z|;Ci]TniTq%郖h|l}U}aG_ zhk>@<73-/)'%953+-)'S^GZ[<@VGD~By?w@t=qM H!:E8A6?3;2:26/4.3+0'/$+!) &%                                         %!+%/'0*/.5 093<6?":E&?J(CP/BM!Me']|Ki| )7o5cz"Zr)f9|55?G]E|%wKfP4:DL(Td|S\ZXX]`b`' YzkA^FpucW CzyA:11h Prm`b凯)BkkIT  Gf{qMVzp~gxWps~/I *7YlcOw:ft|ks:q [babaZQPU[JHF:.)+/" ' '%++36A<:75-)+ :75-/+' S_J[\?BXGD~A{?w=u>rK!>K" (Dhp`]ހyއefU['Ep^ M ;inrf~߃bggUtbvi 2M&:n\gmrco?Y!8fCex^_\WPLU\HFD7.!"- "" ' !',..6:E??EE??EJKKX\Z_d^WTUQC;B<:////" <:7/2/) ScDT^A>T?~=}K$>I$:G"8B 5?2:26/4,/),&'"%!$ ) '%$!!                                        !$ % %$!)$+%/%/'2+5/92:4<7B :G I%M!AP%DV&IY4M^&Vm&\xA`r !/L}.t(l,n?|PQID7aAmt2 3  mSZVP:Jl"aeRgC\mIQiGTw`thTTvWaU{4)|$v1GQB 9>TZ/8STJJl$eiVd*WhEPgUVxaujWMkTgS!3`yIy/AvAHOIJPQLQXZUW^XPIME:-/ ''!/)')+400RaEV`D>\HHHEEBC}B|8t7p4m6j5i4g0c|-bz+^s*]r'\n'Xi&Vg"Rb$O`$N_&JZ'GW$CT%CS%CS&AN&?J"N ?S CT CW"G[%Ka$Od.Sf!Yu"]~Cg| !/EvDr>v4{--;P`KHD;7`.Zz8xg/]?KIk&fjY[/I_APoVVxaukY@pN?TAV CZ"E\"F_"Ia"Nf"Qi%LdZw'dEj,8[JrL|HA57:AZ3W NH)gsb( 2fH_Fi$eiWDeHKd\YXVx_sjW?܈;_bb Ynw ;i[HV]`Tz"Cf푟&/Ed}lklZ j>o0LppWzqms]wT]q /E_^d63QTUVPLEC@?A=2/'!  '+1/69EMPPPTTPJPPJJPNDC><-%' & &($'///+W`EYbACaNLKLJEC@}:x6u4q3n4l6j4h0f/dz-bx+`u*]r&[m%Wh$Uf"Rd(Pc%N_&J\&IY'GW(EV%CS$AN$>I$igJBEh"dgTCz]L{h>nWy\shU^YcdhPlm5Xo\tZQZc^ Cer ~Xhhgd$4m -HlrNlgo ~ivmXx 'EMN_>W9QUWYRMF@AB@9.+%!  '+1/69I!:D 8A 5=3;38 06/5.3,2+0*/*/*/))))))''''''&&&&)0)0)0)0)0'/'/'/'/'/'/'/'/'/'/'/'2'2'2'2'2'2'2'2,9,9.:/; /< /< 0= 0=3@3@4A5B6D7E8E8E 8I!:K >N!?O?RAV"DY$H\"Jc%Le%Ni$Oj"Qm$To$Wt'Zw9h_[>h )E)F+.*UiTQ:Z**QTm,ak>N;`*|cb/Fh"cgTc/uj`DWJzZ}\shU?y\sfm $>]x_g5AoTcahe툽 Ces] ,Rhagt ?DqJs|dofqavcml?c :EygMf\tp;WY[WPIB?HE@@.+(").318;?GDHQVUVZVQLQMA;BK><:6'!$,&**'&/.2-[)dN^eHLiUTTPMIA?~@}G":D 8@ 5=4< 3928 06/4.3,2,2,2++++++******))))*2*2*2*2+3+3+3+3*2*2*2*2*2*2*2*2*4*4*4*4*4*4*4*4 /? /? 0@ 2A!3B"4D$5E$5E4E4E5E 7H 8I!:K"N!?P$BS$CV CV$EZ$I]%Lb%Mh&Pj%Rl&So%Up$Wt)[y+]|&Yt f)oHr 5AhPgd{,gTW[UNG?AM?;<9) %! ../,-')&//20[%MEcQH`MTSQOHFCA9z7y5w4t1r4p3o5o0j+f/f0f0c|*`u)\r+^s$Vg%Uf"Rd$O`$L]$IY"GW"FT'DT%CS&?M$>K%~ ,@@=.36CDEQLNRRNLQSQOSNIDIGE=94)%8:699<84'WPDfUMbRSQSNJDC?9{8{7y5w4t5q5q4p1m/i/h4h0f,bw*`u.`u*Zm(Yj(Wh%Ud&Qa$O]%L[%JZ(GW'DT$BR&AN&?K'P?T?T%>W$?W$AY$C['D]%G^&H_&I`%Ea'Hc)Kh(Mi(Mk'Nl(Qp'Tr Wq!Ys&\x%\y']|$^%b'd:k@k"d/w ".5A8RQ5Q,EIa/.AqW "8\mM)2/   %qr?)K$ ) ^y" .  N{\!,j 'T& 0xysVjF E!8_Nfgmg$cN.&Wj>xq9_$Qh2.IIRNMHAEHN<@B>/&$4>87~9{5y5w6u4t2s4p/l/j4l1j.dz*aw/cx,^q*]p+[l(Yj&Ve(Sc&Q_%P^*K\'HY%ET&CT(CP'AL'R!?S!?S"AW$BZ"C[$D^$D^(Gb(Gb(Hc'Je&Lf(Nh'Qi(Rj(Nj+Ql-Tq.Ur)Vt,Vv+Yx.[z'\y+^|,b,b(b'd+h-j+bEDIILNYTUZZUTYWTRXQLGMMJAA<;0*0'$,,/.1D?:=BAA>.ZKEfSJaPQNOHE><9977~4{5y5w4v4v/s.o-n4p2m+f|(dy/fz+`u*`t*]p'\l'Xi$We$Tc"Rb)N^&K[%GW'GV%ET&CP"@K$>I"T!?T$AY$AY%BZ$C[%C^$E_%Ea$Hd%Ie$Kf)Lk(Nl)Pm(Qn*Ro)Uq)Vr'Wr)Us+Wu/Yy.[z*[|,\~+^.`)`,b/d,f)g,g+k-m(g>r3uD ))59K-}4Q'V;&KT9jP6+ZKcDf@>HAQjfCb_QIg?ZYi[tauhU[`h[^``IXo}M]v|ZxzszPx}fQf{obOkkflm`Zhd\dXJo_ZDbIz}n>:0,5,/3:48E V>V!?Z$B\$C^'D`$Db%Ec&Gd%Ig%Jh%Kk"Ml$Mn*Rr*Rr'Ss)Tt(Vu$Wv&Yw&Yw+Xy)Z|,]+^,^*`-b+c-b/d/f-h-h*j-k/m-n5l%h9~ ,/2 }H%tr(~PGGE!QH>64Ngyy{9*'6/3HNb<6f`Ph0?TP`TRLkЃ|rzllo~zshokykaZolkeifjhfhZsvnQ]K]ZihcVOTUU[UVZWgRD=<=>374/%  :?>AKKLPQRZWX]]XWZUSQTNHBGCA=:?<605*.38278DA@>DD>;1^%B<]E:R>GGCA;<:7:85442}2{2{/w)s,r/u/r(k&i|)k~(dy'cx%bu'_s"\n"ZjYh Wg$Te"Qa$M^"KZ$IY$HW"ET CN"CL!AK!@J ?I>H=GN>P?R?T?T ?W ?W ?Y A[ A[ A[ @\"C^$Db'He'Ih&Jk&Jk%Lm&Mn$Nq&Qs$Pu%Rv)V|)V|'X~'Y'Z)[&\'\)],^,`-b)a(c,g/h/f/g1k1j-k.l/n0p%iEwIY )4"MRSICS`EAL1?D7__TPUD`cUJWMQqdiMWqqhl\o_UbhbnJ3QO7GA%EO/NBDKnfbbakorhrmbVn`EeqiViRTK^Z]aa^\WJMSgp\UTRBRQ=Wm__8:>:;;:;-44-%  '<<47>51<=>>CDAD?@A=:7^)=8_E6QAECD?><<<><764244.z,w-v/w/u,n(l+p,i~*h|'fz'dw(`t&^p&\l$[k%Wh%Uf"Qa$N_$M\%L[$HW"FT$EO"DN"DN CL AK@J?I?I>H>H>H>H>H>H>H>H?M?M>N>N>P>S>S>S CT CW CW AY CZ C\"C]"C]$Hb$Ga$Gc$Gc%Ig&Lj*No,Qq+Qt+Qt,Ru)Tx)Uy+W~'Y(X,[+]+]*^*`'`)`)`)a+c/f-h.g*i.l.o4k4m7o3p3p0p4r6t:wP~P` ,?I"G]<| ,nbILH8JCW>..8CKKOVM=<072*  /CPEKQQTUWYb__dd__bXTRVOHBE;:7<>A;8G=?DIFLMJHFBCGA?5_,<7]D5VCECAB?????@<:66440|-y-y1y2x+r,n-r.m-m.j*h|(ex+bt(`r(`o*Zk%Wh!Te"Rb&Q_$O]%JY$HW%GR%GR%FP$EO"DN!CM CL AK@J@J@J@J@J@J@J@J CS CS CS CT CT CW CW AY"DY$EZ$EZ$D\$E_$E_$D`$D`&Lh&Lh&Kg&Ki(Mk+Pp/St2Vw0V|0V|.X|/X.Z,[-\/]/`/`/b/b+c+c*f*f/f0h2l3k/m-n/q4r8q:rX(Xc.Hj_jQe\U=[XOehhyp^^u\rpjppmc_cjhzvd|fq`ofdq`ghfflfV^[^XS^e\VM\?>4UN"4O.279<:??425*  "9MRIPTZVYY\d`bffb`dZUSXQIDG<=7<>A>8G?TF'.?W)%u}'}s%0qn|!q2]y7j+r&Yv0\v0g|TfENp'YgffDM:SkNVt ?OTV2JY'Q\!?L$8H=H0P]0FV CN$CT=M(T`FS>KAN$Uf[ Mg)Wm E[,Ro(Pc1Xu+Qt'Tn)Tt.X&UtTal"Cf.j>\%] [sOe8`%\c*l)a3d+i&kh,o>w'`Dx5l4k?t7v9x;zv`U;HEDFGDLVOIKMG?DH99>CB<<@=:@=AFHJIGIGCHEG??JG>½*GMI-C::8:7779N J>I$ Az?sR+fWJ>KDP%GW%JZ:HJWDR!R_CT M]EWM_DWAT@V*UiCY$H^$KcE^?[Da+]z$To Nj2]w$UvRoMq/dMs-e/f [Z,?rCoYz:_es:]?j6k&j)m2m4l0m/q-r2qv>vCyAv6w8y:{:{:z:y<{?~>AIE??COKJSUWW`TSOKKOSTZZ\^``baeddddc`cgeehkmlj`ee``ffc`bd___`ZSZGW]XE1/JT9''B?<>A@A>>A?BDGEHECAEHED=JG>½*HNK,C88:7:::8W&MY%F"%!r~ n~{)^r fxu\ggpcv_idd\`$cqYkPZjg)fpIVGSOYIVU``iN[$HW*TbGT"Yg$Zh M[7E)Q`']kET"Zj,aqDY!YkUjI_Ld$Yq/^w&Vo3_~ IjJm!Rv'dXYW|0pM|!ge&s5d!p:d_qEp9bBqx6q7mBv8r:rC|9st<|>}???~@~AD n*|?CELNICNSJ=54>ECACD?EOMHKNIBEJBBFKHB@FHGHRUWX^URMLLMRUWZ^\_\ZYb^[_ab^]hfffjjih_cdcdijh]b`^\_\WUdC\TRKLc*3c1',H$9/3U0 ]D0/?HnBC>~QQw7J|XtDOe(%O!XDB>?EDD@GDBBEEHECAGEHJD?IE=)JR!L-G5769687=?D8"f3_U;z4s7iEiGx;oCvLA~4tG>w>ACCBCEG?GH@9?<>(/2:C?^k&Qw8Q3J:/ /m4 :/'"7)0r3?EAgdQP2jR%2MPj9dh/$'/D1EC?DGFHEKIFGGKHHIHGIOLIDHE=%FNI,D55456497&o\:ruNwr{;ins욷dn7D V`.^gil4A6u~Um~bj{BP^l_oL\KY󈜨'5?[%Rn%SqKj/d"Jb En9fcJns+IysIiS{8a-k\l2gn2}_4iI<.tFEACDFEEGH;zCJHDB>:?:7AKTQKJHHHHBGOJGMOMGIMBADKH@@E>>ALQNSVRQLJJLQRKORZZ^ZVb^Z^cf`^d`^^aa`ZZ^`]^b`]Z^[TRWWRXW\GT[yT Ty k24J,HW6YD0R PnaMMwHP'g`g`k}U9xd^JHEDIKIFIFECIKHEEHGLJJD?GC;CLC%B//1/41531qV~Ez[`NZHYEdp9w}/0N[Wf+rRbxH^rFe~:^|0Zz"Qs\/b?W@fJZI\p P:iv(ua9mA>1}DC>@BBBCDGHNQSPMLJ7:CHLRV[JHHHH@DLEBGMJCGJ>>BJF@@F>;@LOLRTOKLJJLKOJNUWXYUUb_\_bc^_b_^\]\ZU[`a^^a^ZWZWOLPOL9Ap\,) aQ{0` eyeq&Ea]`,< %"9E^u?  _IW!Q8 >2c\T pHZM~GI/GLHIHKMJGGCAEJHKHEDGFFBA>EB:DLD%F..*//004Jج^`i݃wnqGhkhTd>s{s;:/.GWhq ROZh\mGZQd%03sC\Ih!Zz!_`!Tue}=\u J0DMXjR~ꄓ)JyןpƂDk5~(|n~Hw>;:D>ADDGEEHIWVQMJHEEMPTRHFKMMJJKJBEMECJOMGJM<lz @Kvy|aRTEZO!W,r|^caGNBWMir<2$$iȕ@sP.tkUSsyfsOLKJMQNKGCHHLQNLIKHIFE?>DA:%LSH(G++..2/44NF}vtz/RgjPWk/VKZ!nfyar`@_cv%^rd/s^\Fle|𚰹鈙ӊMfAၩu~meěAq>:BKROIB>KJHEAAA>QOOPNFIPIGNTRMNR<CC@?>HJKLQDDDEGDAb42BE\j}jB _aRU\]ke{&l`:"8WlCʾ/BM5(CE QFI[Z_YUWUPLLTRQRTVTTRPMOKLHCLJ?!27E)')(-...J;hV~\%t3k9yHJt'zdX2eiu~U:v5y\galN^kBrQw [ljm hq.k|臛T~&c$h(l2n!ZzW;wGsiI\RuS}Ep Nev3ZcGsZb%U9hWvfd/h4q璸Lry^@46>CJCEHIIJKLFGJKKKMPLNJJGGGIGJLMLMPSGIKHA><IDFGD?AE?:;@FBDHJHGHJJGCNMQU\\]Zd`[Y\^cdcc\WWY[]TTURTXVPLOPQPLMG7C/Rt T; . ^M3E1 + !.:. '1 )rq {!|&w!p1y5v `xJՠpSp&i4w/p]2laxjۥ*fMG/m+ic"i2yG1}m.|5%xEH>I3xhǰuDHJHDGOYLNPQNMNPKMPQPQSUPQQQMNORPRTRPLKNIKKLG@anF',YO% AJrs= 8c,PyEeHadlvUV~4<^Xo'| >qxR%ZTSWWSRSWTTTTTRPPOKMKLHDLJ?+:<O$.+(("*,258+UV0G~)/*+&+'%%&} $!|&&s s.y$y$_|.`Zs(i*m-q)o@~1o.l.[?^2a%vmAp?^2^"m,w/y7{/lX^2pCM<{GL;}C>CD@@>MJHHIKJGACIMXYYYc`[_``a`YY[\\ZXWHMJINPRINJC?;<@?,\AI5~Z~4<)[i<@nx$mFnq}XH^Z7'I<>geWv>ZUdQnBOLLтlRWSPTWSPSXVTTTTQNONJKKLHDLJ?%5:L) ,..!%+)TY/3KQ<.>42%4//,"1!&{%'"}/ u1&){u$sA|4|7~7}*t%l4v4s:wQ6f,ehh:rO}7k70|3yE>z4oH|7mExM>t3kKG2qK8=DBGA9wD@JMKEHKLKIKLHKMMMNQRMOMMJHKNMNPNJDAAHHKECAEIABDHIHHJLILOOOOQSMNOLKJLJKOPPKFHEHKIFDDJKC?BDD?BEC=7::.'0GD??@CCA17>EOSVTYVXWZXVTRSWWWRMJJKLGGJG?KE<5-*.,;"$ E` _'!4&9>Ka004\K>C?`V/NlX Q'3!''+*-0  <.D% AM$ º(0,/:'$!@:/t!42.x6|7x<|7w.&}(pR~Dq:~"y1A|G?yDF;z;}D>|A<~F>4D7H}V>xA}KCJ/~@GLIGJG@FHKMMMPQOQSTSTWYRSTPMMLNNTVTOKKILLMJIMNSHDHHJCHJEC=>90,4JECABDDD:?@KSWXW]YWVW\[XYZZYZTSMNONDBFE:QNG@8/)%$m cWD+BH+T1JN$)I[T>&/N R\:Z?OWZ90QW'^/O^7T)Oct+T=+gNPon(0$g`ZW[[WTUZXVTTRNKLKFJJLHDLJ?+:7J7.044.+04+...7/)-//$),,)%2/*()%+())+**&41.1~27~7{4y?|>|>|=z=z>|>|?|A}A}A}D~D~EEEGJIEDHGCFJIGEIIGCHJGEJLKKMMNKLLORTTTPMNPRTSSPPNOCLSQMHFEHHIOJEFLOIIEGCDK?99<<024:::CC??BD@AGJNJIVSMMMQQR`ZWYYYTK:0*% )1<@II;>:7,,,2,0220-264|<{;z;z;z;z<{>|?~?~?~?~AAACCFFAADD?~D~HGECEGCAEHECHJHIKKLHJILORSSMKMNRTRRNLMODISPKHCEEEIJJEFGIECEE?BC>99:4.'2936=A>?EHJHFVPJKOPRRYVTTSQMD?DC>@><57>;($% '-;?EE7::4(((,"'((''(,09AE>;/'A<6--6|>|?~?~@~CCCDDDEEDGGCCGEAAGGAAEC@CHIEEJLJIKLMJKKMQRSSOLNPOQSPPNONIOUSNFHGIDHKKCDIICAGD?===442=75>C>?D5<>AIJJJRPKMOSQUSSTRNIE>:1;>8*$ '/<@GG<>;93+-1  "7>GKE>//A:9++9:@GCFLSSTWUPPSWTW\b\Z\^YWWXWVVTPJDKIFHJHJHOM:/?>N$9(-11//34/.+1-,*22)++'%),($(' !&-))/31/+676::<:7A?>>>>?ACCCCCEEECGGCCGGCGIGCDEECDILIHLMLLNPQMNOQTUVWRPSURTSSPNPSLQTQNJHMHFKMMGJLEBCGH=<=GC@F@=8>>8=CECCG::8DINLJQMKNRSWVRRRPJA<9;729 "$$""$+AIOTNI?9HD<88;CEKGJTTTU[ZUT\\Z`cd_\``\Z[^^\\[WRKOKLMKPLINL91A@Q%:).1/..134507/.*25,,,*%),($*' !!!!!,*--241,:759===:AA????AACCCCCEEEEHHEEIIECHHECGFBCJLHHKMLMPQQNPPRTVWXTRTWPRSPMNOSKSROMHJLEEILIFBJECAGA918FAAAA8:9?;;DC@@H428=HJKILIIIMMQOIKLJE>6/:>?6CJKJOVZWW[YUX\^__bga^ab]Z\^\[YYUPJPMMKPNMKNK9-??P$7+/1/++./44.1-+)0/)++*!")$"*%$  ! -,*.040/8577<>=;>><<<<>>???AABBBAEEBBGGDCGGACDFACHKHFKLKLNNPLMMPTUVWSPTWPOPLLLQTJKNIA>DEBBCIC@?GA<>=9/+2?:547**5927;?7=9<97;<<;;;9:BGKHMSZWZ\XUU[_[\`ga_aa^[\\ZWVUSMJLKHLLMIKMI7/CCQ$7,./.)')+44.5//+2/+/2/!!!&%$.* %!(&*,061-:767>>>>@@ABBCCCDDDBGGDDIIEDIECBGFCAFHDDHJHLNPQMNOQTUVWTSUWQSTOLQQUHLKIA?EGCCAGDA::1+,48..33&&+422;877?+)'.:?>7C?CCEDEAGFFGKC:*8:9/04<7.,  '-;?EEHIGE==ACIJKNWYVX\WTW_^\Z]e_\``\Z[\XTQPNLJMJLJMLNKKI45EGU(<4554.++,775:74163/797(%%)((4/'*%! !(&*,002-:8688><<::A,/02::<:FDDCIHDAPJILQOB848516<8:6<<4474,.3;3,36337842443+!CEGLLKC@?=CA@ACECCIHEDDGHJADDABGHFGKLIIMMJLNQQPPRTOONOPRPPSTSRMLLPMPQOONQQNMLPOKMRAGHJC?:<:67>:74;7//40(*.:/*04004421030(A?@DGC@@?=CA@ACECCJIHGEGIJCEECDHJHHKLHHMMIKMNNNNQRROQRSQRRSTSSNNORPOPONMPQQKJOLIHLDBFDCA<;>8;>>76:7//40(*.;3/47436842264/(9<9?@?:69531120,,11(/-+"  '-;?GGNQUWXW^_ORUUW^_bUWUTQOILGDJMPMMSQPSWWVW^^ZZ]\WWZb^\`_ZUUNFDJKHGJJGIHKHHFTN5=JGS//454/../4..42)(.61045+-45+(*-(&(*%&"()&"%$$&*,*'+(*-3431:7<:@<4474,.3:/.37313742363/*<8278=@>00/.7:<:/75*+4/!")  $$""+2?CKKTW\^b`deUWZ\[Z\aRTVTRRNOMKOXWQSVXTW[_\`beaadd__bfa^cb\WWOIJLPNMNPMJLKMHHQK4=JGS.57751135/)+11)).5+-25-/15)$,-($,/*'+,**%*('(++(%-,,0665477:@CE<4:<4474,.3:0.7:404:764771.74/047<8''+-2=?<+/+(,3'%  !!""+2?CKKTW\^b`deX[\\ZWX\KNOOLLSTMQT\WSPT]Z[_`^aefbbeeaaegb`db\WWTMKPSNQTNLLKNLIENI2@I?2.47//40(*..''.3+')1/--./)')''&/02-'!(-/3/ ("!!    '-;?GGNQUWXW^_Z^_ZTTST=AGGIHQRMMSWULOSZXW_`^`bfccffaaee`]`_XTTSMJPPOMPMKGJJHEALG/:IGR'1221,,26' $,,'',0%!),%&+40,44+*,,'!%(''$'&&'++)&)(((+-,)-,14:>>=CA@ACECC>?ADFHJJCFGEFMOMOSSOPTTRMPRRQQSUSSTRSQQOXZYXTTSVHKJLKLMQLJHKE@?H9?BA<>>??;<>72).7//40(*.-''/3-'(/-+-..)'%" '..3/-)!!/,%&"!  '-;?GGBENSRSTU^`_ZTQRT9;AGHHQRLOSWUPMSZVW]\\]cd`aeeaaed^\^\VQQUMIMQLLOLIKHIID@JF/8IEP&4662116:+')/2,,27)&-*,(07-/782)+*&%%('(&"}"}"}%')'&&&%&')'%~,*/2:>>>CA@ACECC=>AEHJKLGKLILRTRSUUSSWXTNQRSRRTUWWWUTTRR]`^\WVUYLLNMOMQVPJIMKFDK?CDE=BEILSXRQTZVRRT[VW]b^aceaaffccfe_]`^WQQVNMNQLLMNQMNJKEAHD/CQKV%::7:?>66>2./772.2+)'(-..1-,284*$,$%,41//*)((,//.)-+/11/~,|422367:3DDBCA???BGFEDJJGMSTSSWWTHOOKNTWVLVYWW[\[PU[`^]\\WXWWSUX\NRY\YWPOGIMJA?>CC?>:611661/ " $$''''''  $$(,02:?BEBCHO\^a\XVXZIJOOMMOTKRWVWWZ\d`^c`^`biffigddgg`^``\YZWVQWUTPRTPJILIHEY7N???>>BGFEDJJHIOPOPSSPNPONOWYWNTZVWZ\YNTY\\\XXVVXTTTXXNQVXWSMJIJNJA>;?KK@?@>../2,,44.07,$-37::>DB?@DDB@1-++-/+(  $ $$$$$$$$  !!()-0379<;>?IOTUUSSTWCEGGEEGJPRUVWVZ[_[\^aZ\`gddffccfc][]]YWWYQMQQOKOPKIFGFECT0L:<CHHFDKKHEKLKKOOKORTORXZWNTWSUVXVNUX^]XZXTSVUUTUYPUWWTRNPDKLKE?>A227>>;<,.+2,,44..7/)+6777@ECAAEGCA<:77::71%$$$$$'''$!!!!  !'),0057;9:>E@DIOQTZ^GHKIHHILPQUUYZ[[][Za`]]`fccff``d`[Y[[WTUWPOPSLKLKJDFCECCN,H?LJ Z&82/142*/7,)+//)$)+)"+-10./,/771),4+%(('z'w)y&y%w%w&y(|)}(|'z'v&u"s(t/v/w4w3v3u3u/w6z9:::A?<<:>?AEJJHGNMJDIKIINNIOUVORWWUOTUSRSWTTX]_]\ZXTUYZZUVTU[\\ZTVVGKPKC:=>99>>.//700770073+27><<<>>CEGKKJIOOMGKMKLOOLRVXSSUWQPVWSOTTSRW]_^ZWTTY^ZYWSTYZ]]ZWTYGJLIE<;??>AHE?@HI@?@@234<42::22::24@D?AGRPOORRPOROMNOONKKD@;71/$1//-+('$'--''..*"  " $$)-067:@CM69CJRX_dRTVVRQRVUY_`a^_acbbggeekgdcfd_^bib`bb^\\]WUUURMMLGCCCEECT/N:GFZ%474262/2>2./55,),'!$%/041:008;8/-5/+,*~'v's+t&s&s(u+w.z.z,x*v+s'p)n)n.o3p3p3p1o3p5r8v;z?~9}8|@~@~?~>>CACEJJHHNNKJNOMNQQNQWXTQUTSMWWTPSSTQV\]XTRNVXYYVTTVTX\ZVSLPIMOJC=<>B@DKH@@KI@?CC466<44::207<<6/.//..+)))/75/166/'.+$"'*$ $$),02379<;>?I94./54,)+ ""%,.1;0/685+*7-).,+w's(r&s&s&s+w-y-y+w(u-q)n'i'h,j1j3k3k3k3l6n7r:w:x7w4u|?~?ACDCHFFDJJHKPQOPSSPPWZSSTQOPUVTRUTTRWY\VTNMVWXTQQRTPTVWTOGHHJMH?>;?><@ED?@HG?>@@23670074.,2@::CGAHMZXWWZ[XWZWVVWYVU[VMA@6/.++++++++165//44.*.+" &$ $()-057;9:>EDGIGEEGLSTUTRQRSTZ^a^]bbda`dc`_ec_^_^YXZf`^``\Y[[SORNKEEFC?ACBBAP,L4@BZ$-7212/*1<2./54+')!)*';0,151(%7-,11-y+t*s&s&s*v,x/{/{,x*v.o*l%h&f(g.g/h/g3h0i3l4o8s7u4r2p8u:v;z?~?AAB?DDCAHGDKPRPPTTPSWZTQVSMNTXSTWXTVZ]`ZUPRVWSRNLPTMQWYVNF?JJOJ@>;A;90144.,20*(.<6;?D>EJXWUUXXWU^]Z\]]\Y\WLG?<.+))))))++/55/-13+*.*""  $&)359<9@@?>I,K:WUQ6U27:9570433430.'&  *$( "%,,,)%:841.}*y*v's'w'v'v(x+z+{+z(x/y-v$q&m&n+n+n+n*n*o,p/r2s4u5v6w7~88<;=>?>?@CEHKLacfe`bbdGJONRUVO``^^[\WWTRRPONKNZZXWTRUXYVUQIEGI,,,,,,,,3:KS[`adcb\ZY\NPQPLJLNOPPTSTSSgbcdga^a[XX[ZWWZ^WSTTQPSTPKKID@9LHGEGGJG@1;*;.N:B$)$$!$ BBEDBA>:  ~}|(p(o(o*q.t/u.t,r/n,j(f+b+d/c/c-b/d/d0g1h4i6j7k8m4o6q7s;v>{CCDGGGHJMNO<@AD@DFI]ddbfkjfIIFFD>>>RPPMHIIIMMMHGEILOLKHA?AB1/71,-,6,,6:A?CDEHGGEIFB```^_^^Zhffabb_amoonkkkna`a^\[\]Z]]\WWUXW]^bbfffWTTWURPTTTTTTTTTNSSX^aeejhinsxzx~yvsqjf^^^^^^^^^cd``dc^RUTONQOIGJLHHNNIDGIJIKMPOR\^fkov{|zzutrseggfdcdfrpqoorooXTX[ZWUVZURROHDHPHEHJGEHNJIIGGA?B>;:??@?M$<.%C2  +/)/0/.+)' BAB~?|?x=v>t=s'u%t!s%t'u'u!sq&j(h&g+h-i-g*d*`*c*c+d,f.g/h0i0h4o6q4s9u;z?|?BCBACDEGHYYZZZX\^UZWSSQPJ/+.',)++???<:7:64:6600-0" $%$''//5 %%'-1?CNSTb^]^`b`]_\WSNKA;))))))))/563365/$+8ACB???<<<<:4359[[URLICA86320.~/{/z)|({%y%y$w"vsplj"j$l(l'i$gc*j*j+k+k,l,l.l.l*n,o/q3u8y9}==<<<>ACEGTWVXVWVWikhffhhe_[]\^^_aQPMMHJKMRSURPMNQEJLNHIILDIKLHIGKIKMTTW[ZMECKK@@HPPPPPPPPHKKKMMMRWTZajnpp{yxy{{zy|xsnjdcZZZZZZZZ\ac__ca\NTRMKNNH:<<77<<78<@AAAHMKQUZZ]dfnopnkghi_`b`^\^_jihhdfcfwvu|{ywyyututonquolnlgdejgddd`\ZFABADDEE?.A <794977542244A<;:@<<74/&!  }{y7w4u1s/r/r/p*l&j'e'e,e-g0g/f1a._1a0a0a0b0b/a/a/a1a2c3h7kAAC<@D?>EGG[[X[ZYZ[UUTTUUVWJOQPNHHJ9=BBBAAD?DDD@@@@@@BJOORRGB@ED>>DKKKKKKKKJJJJJJJJXWX\dfjjusrstutrzuomkfbZYYYYYYYYZ``]]``ZKOOIILLG<@>::>>8>@CDCDEILNQTVV\_kkligbcd[]^]ZYZ[XZX\XYXZNLLUUSRT^ZWYUOLOOHDHF@;;A=<:<973% !$`KADUUC+///&&*(''$!$'' !&$>:720,&+>><<>A??685CECDARPLOQRTSpP:vq 4    endstream endobj 14 0 obj << /Length 964 >> stream BT 56.88 373.08 TD 0 0 0 rg /F0 12 Tf 0.0072 Tc 0 Tw (ISBN:) Tj 32.04 0 TD /F1 12 Tf -0.0083 Tc 0.0083 Tw ( 0-07-237965-0) Tj -32.04 -18.84 TD /F0 12 Tf 0.003 Tc 0 Tw (Description:) Tj 63.24 0 TD /F1 12 Tf -0.0008 Tc 0.0008 Tw ( \2512001 / Spiral Bound/Comb / 256 pages) Tj -63.24 -18.84 TD /F0 12 Tf 0 Tc 0 Tw (Publication) Tj 58.68 0 TD 0 Tc ( ) Tj 3 0 TD -0.0288 Tc (Date:) Tj 27.84 0 TD /F1 12 Tf -0 Tc 0 Tw ( January 2001) Tj -89.52 -70.56 TD 0 0.502 0 rg /F0 18 Tf -0.0075 Tc 0 Tw (Overview) Tj 0 -24.96 TD 0 0 0 rg /F1 12 Tf 0.0049 Tc 6.2788 Tw (A laboratory manual for developmental biology offering basic, easy to use, laboratory) Tj 0 -13.8 TD -0.003 Tc 3.6563 Tw (investigations \(18 experiments\) spanning various models including echinoderm \(Sea Urchin\),) Tj 0 -13.68 TD -0.0046 Tc 0.0246 Tw (amphibian \(Frog\), chick embryo, and fern gametophyte.) Tj ET q 286.56 0 0 -362.88 151.68 797.64 cm /im1 Do endstream endobj 15 0 obj << /Length 3 >> stream Q endstream endobj 3 0 obj << /Resources << /Font << /F1 4 0 R /F0 8 0 R >> /ProcSet 12 0 R /XObject << /im1 13 0 R >> >> /Type /Page /Parent 1 0 R /Contents [14 0 R 15 0 R] /MediaBox [0 0 595 842] >> endobj 20 0 obj << /Type /Encoding /Differences [105 /i 118 /v] >> endobj 21 0 obj << /Filter /FlateDecode /Length 231 >> stream HTMo [@CIQդ۝!59?Q!1x"ݐ>yh7w"IF,YnGn; endstream endobj 23 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 7820 >> stream HTyPwbpx^/ZGkgj<"@@@# $"ys@E%`@UѥkluuumWZYλ3<gа Fqw4~A~TxvK\iٟ8_ NS?ĂhI 'W+ ټ~E4 ̫+ Kbމڲ|~noiEYiśaX,: OvbX ; K 0,6 BMEm zL/+8<\`fQKf*\z|deٹa+ªyPE|gy ƊƕXj_X5L$xkߏ޻nɺ ƥYOGPʝNffefLl0mQ y\+mBRwNMK:vC}*۰[SI8|~vg|F zIpDK ZIC5h+u.4u: L쭎j4ge@؝m:d6HrH(*Dd*AEMUDm6_H ^؇΋CN(LnBQ4GG(o-Z-kYsY=+'%8.?ץ. 1/% $AmJyN_j2  1HQ*u0_kٛ/Qt$Z@@[8@N?x-=#Kڠ8rO9fb\PZfG z{|}+ҶSI Yc4-fDBwu<{ygSB\/.J./*,L[ɣ_b}s=dkF[4tmwZqzV5 B/b n}b%=JnfHdX!Y&S&8LPg]"ZQ :̰ڮO؁EӤlA1k՚JC 3;5BrLKn2CF ĝMn8>nvw6w[dF"٪${?L'hv,St:YU*j`U H.Z v^h$("_%WB>__ /]O^u='xtnL@0dRS^ C?B>P2?qd \fEޒ\x{AgN; gN*ZJAR#fU+d?ӎ}{ mAè/'((MVI˔z%KPۦs~$;/%畖^uWpyUg:$;fU*+8Wj:.89iFF'1jtS9~>!s zp?>`u =fXLVՂQEٿ|bZvq^"h'*@Iuu@jotAO&,1;;Pdufz_I<`MP^Oȵu>K۸$r(vv@bߎ="IRaFW@A_ګ5둥'-Ż~gHCH;$  Nl!,$KҮ+zKkO ٦5fLN&<:鷙GWf:d{={﹧Bd{UuAsu[tÜV_J6[O5uPV)%/5hvl.į`͝ Q_1ztn`&V̙+.pE׽%+lwhZdX [x\dB1Ϟ ];V>oJ\5)=& ;=z#~+`fuh)߫/>5 [wmyv3s՟( +A7g!t}#)nI]+Ro \hdjUz[$@{,m²6??=K7#MvCq>ؽrS?{ҳ|kEvW5&lo;][.l_GHӢ+%P2JƬQ:jE^\iTh͘dkS!1 fc C`x"y]zszI/:8lӜShh\y }8jrs̹7lL3㪐uYSFĎH3/Pla4"pGnP¶&m 'TERRԺ 7̛kW$ЀChuZ }O1g1K\ /v\!W>ʋ 'cL?2!$o`efMTo*B%~Dd*A S 6&5 VRaD|`^:H$0֙N% Zc]Zfd6oXpu'>aUa|y,b kg{Iu$ |){{îBH]*lb"SE*H1TbJp*ȣik褆{}5'F$`뷄N ´R6%+"/pOrP'ߢF.CiUC VK.bVc%FIB}p06( Pnvccux)> \8nJ\p`,}؋Z:.=K-M]=#8j ~z[0UwpI*Zx󅹅"x3 UlQt{P;.|~(ǵW5f^-ֺk/p[we  1t908u1Q6up2НǓ#Me[TƆ}"Z:"X]؝j6Uݭv[ȋ,SmcR0l'O-hh1r|ih1ߚ?*..mNoЖ3a6Ԅ܊.Fh4MZfmVs~(3Gz$/^^Zk:Ti2?."*ݒ` +Q^̯ů~Iɟo[U{O" ir{>W[8<5޹Ŏπ #C@ɶwpr}npv;4,Mvb76k nZoc٧1M g./eWX:mW62(ϧ5hp[L:ܢ65iHk?WsTgͮ2S:> EJ[ N- BCrOlsv95fs!X䢵 E-t2'~)>O"ǣrPIlw.?e-l::)U#Z@T@:NHi a"XAShQp:`±YšADWĄ:+2RaKT16{.Q QQWXhI;kK_Y.j*:Q"*De0ōh4$4Ao˪2oGieo٢(UiMXmX>#!xq" bOSpE%2LlQurd!!ҠNeLdBaM+S@lL#;Cd! t:~&k2&2 >٭'&W?PX*'<΍=2rzHZYZE԰LȃQ.й\=O1 Xd#CIWB/jlC ٍI1pLa+hnwbqW6s/j(MðpiR  5]Zmz @֠[RhJ0}NPgnz4VG&O X/b$hAatƝIm~K}cEٻ!?+ād5{ݍfblm'ᷰY͒:v)K:ANn ̴ <[ٮlEvGu91h:O7He{J0ȏsrsgzB9:vaʼn?^_k>X0Ă T;L! Ô3؞۬lQ?_&\rQ>0*x~r-6S)4&@eGf?GЪ%=]KE*NmE*'[*Uq`x*hxI!o*NeZ_E(NJ,sf/zhQk12(QDy Y?c{flόxƳ~:n說t@DZ"ZO[>~ZRZ#s`a6C`,]V9bjͰ9OŰ@Uqg4ӷ>Wvo~Ӈ0|n@#z///ݔU AR */bptLˠ&_'w?Ohz{7 h XS|X-(>-8,]Qv":缃2!c=U[x"EzXO#d2\[zDGRp$(+(>)8<헻В8׋A"|!BR/5<9iyۑCم~[}ˉ =50}KzZrGahBfLln}Ov߆\Ax#>P3o~n پ\'K3>74"uބo__w4E?A_W8/.ϡvhgl2ŒNp#~ n$ ڏc:￵LK (89MwmSW 㽨w&vMM(Gta ћfF\×՗7ދVǭ53 mS7̱A>pgp,\ 7𕷤4;s5췻>1utW,v\{ŚЈB27~KԻ'݋[l <, wa]nэ;no0jMKkރmp3/cUp}r$6u:HlωN/8 AIw.H2K6#'`i˯jD:]*)X: a9LMONbByb?:ZyQ`%@ƭ U2Ԣ*-9̅NS8MM$YqMc2VH(by;nQxE6Wvh!!3P8ON% @ !?blf x#[)^̗6ih91a+gX-h{pŽڪ'vE;yyݜJY|4N"3 f'b01K3F%Ò$#)XyAAfvZ@W8\¿4&*؃ ł_ ͦ$-˅w59'x endstream endobj 22 0 obj << /Descent -225 /StemV 148 /Ascent 706 /FontName /ICHBND+Garamond-Bold /ItalicAngle 0 /CharSet (/R/l/G/zero/three/two/K/M/t/L/P/V/d/y/one/x/Y/six/c/i/D/m/s/b/h/v/nine/W/a/period/space/g/J/T/f/k/n/eight/A/E/O/e/p/z/F/five/r/C/I/S/o/B/four/seven/H/N) /StemH 36 /FontBBox [-124 -250 1247 845] /Type /FontDescriptor /CapHeight 623 /Flags 262150 /FontFile3 23 0 R /XHeight 457 >> endobj 19 0 obj << /Encoding 20 0 R /ToUnicode 21 0 R /Widths [320 280 280 280 280 280 280 280 280 280 280 280 280 540] /Subtype /Type1 /Type /Font /FirstChar 105 /LastChar 118 /FontDescriptor 22 0 R /BaseFont /ICHBND+Garamond-Bold >> endobj 25 0 obj << /Type /Encoding /Differences [32 /space 69 /E 80 /P 97 /a 100 /d /e 105 /i 109 /m /n 112 /p 114 /r /s /t 120 /x] >> endobj 26 0 obj << /Filter /FlateDecode /Length 289 >> stream HTQn0+*HR>TމPb,k%ǘ1?UJ3W;gh{,Nb%^C弝.zf*ݎ ofcX.bg,Aa1̀t.AH9ޮ1*L#6CIT(%VsV~6(DyL,c  p5NCHs~ERQT81xf%۬~Ź}3G.֒oI/Α^hc i endstream endobj 28 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 8211 >> stream HlT{TWa ̤)>q-+VX]k" $I& oG9b[Gi(u]+}\힍޿~{>D""}ÖԭiK7rJN-//N))}}@,6<@ &"x8=TܛOeHHPQ/],_(TV)J+e*e*J(/)|_)ߩTh D^X)ϑ~J'R)JsT|,˩*,/)Q*sr ߓ!)BdH! Ȓ@dE :I a ~@$IF!(TpZ,~14D/) Յ aAaᾈĈ'#Fޛ#MgbQXu(7T1A1cwwe8k$4dEQ@^zOY_lkf.,)(T`}- Vш&W/xS@pbݏv GN UWU,TS҄((Q -sbfsv3t3c0??д7s ,;I Ex^8g9Kgd)Lڨ5kqkɶ#ma1S=6}djʠcֺ/ZFs#= 653axqHѲ3*ҀUB kc^m.kjkt&Jk"PaVTjg;A5 u 0-[Xs4;юcQҺ Là"]vP-ma$+Ԙ:DIaĐ ?Ʉ@3!t1[GaĚJgtE.NN'G+(޿J)a,gIolj3-)p UZmRBZ}ӢA8Hmzamm; K-^FĬI8s3oIVmf>j- HV Sk}L'8 ʷ:D9@{;Ͳ6gWѓ2-ձҚ~!sQ k0@t9mo0d7=ę0v)X)s.k,{ A.Z.aLaɆ7?@TC_9z9~+O0 K]<8Y@JZ#5߬+@|D_ygD_w`G_^yw0U;;3u[0{ {aj3߁y/&]ya4p+r` 131,v52sǮM=:: a0\"W,H2Sn͜Kwmb{@.}G/`{S:Zgnu';\vx7]6:bqJ85u0..`#  m f]dk'+- hST)q4'X3a%XQ<,}=,- }v1vx+m4IjZot3, BOiA:rRtp wjSi[FiuxҨdÜȬEog[#Fn/ޡPRjeq&"Ckt)0_؄u;m?Ĵmy̽)ma)0[-%9< <<*2aW V]ݗ1$-6Ή;iWhɬCP Dπ(ʹ m'$?ӊ3U nx_N3vH!Y~Zo&@ Q_$Rk{ kmiMt^In|5q,ajx\fju_(qHUo 85AN-+dt,`A4Yk-u8klaXn$d}h~B}罴9ܭf?<6u%ݺ)U3L9J E$hq(76N010>{wfggg/x}19jHK8RACJjMZ[4ڇ{~>L NO!w4׶p2{URɳpU8Q$A1JJZJ$2HaI cr詽!*B PB- Ɏ-"/ Ҵ,sq`FߋUom؉AqN82Z0PMDwB=RhH*"*!Pf bXT$L 'H9bƫ pwb U"EfA-fLH⚨N&H &/'7{\n~~ts-;э=Q#tȆ9VCoTwbDF#iSQUI i} H`=O ˻@i~/& :7O3(́l*+ivta>LNs*|#Dȿ ן[pM@3]fTZɩJB 8e"ZGpݭ'8""5DAPolo { ٔ8+ !%1rheT= ސ3'}xg0\7![cȗPYP#0$#Gm)-^)4G3 br "MixcrM(OO nuG?:XGa߮]ZB1%h>q`ŁO/OޚOYb$%MA4x.qiҤq$j\GC$ߋx>?m3&M߸x"}҉ؑON5L Dw ]hcHPAZAuxjI5/YA.H.޹}he;-IV8п7ұT,]\'oh%!2 ETDh4}J/S%VVzd@&˜96;&d%-N^M(x`jѿ?_,XGh UsiBMtg8n!SlXΠZ¢Hueu HqUNY*u`:NR}~yFԠ< !BLgFFRI?hd'h7`9!Z'i< {:uX.|I)F "\P{=s͹1J %9׮hbIuY/Aq)FKJꉔ6Jy;&Kߢ)%˓t0᳽N_7ذCrϡm\zK?* ]Z]kh`:bt 6~L4J&-dg[kwJaD6իV42o!uo5FXyȃ \9K** wMf}sGj'osۦ<èf>ܫgMKK䮊=xPc᱑E4f `L+fᯮ`8#UTwޘ uxy.Nu|WYjCA ȩt ORX!䓝ͬ(JQup0銲: +,(?fr# U2-g S`Ƶux\a^^sQ288;(Q$i42>|fŀ ݼ0LlԠ ͊oYWNv=i_I$/ɚd؉nˬ]2y;j".L,40)΄b,IdQ{B62J0JFA3*dn,vbl;!WCO>[V l jc'Cح5ɑ 6`Ӻ twOϏ?x(\5:6y|~a~ШJ|6JnRyuhD hTUl${)ϯW:XGP t߿ղ, uN!JDǓ^eW?X ts9Rdi{bK~ :ʚ*V`IJs>Q^""); J-F6%_|pN|pxPZxָ!X类+8JtH\8 +j(|~"VMg'F\N6 K cz*Ua&!C%{Yt`}7uVsD;Ek䡊LfÚm߇kLEKfL[BKȮe?Id(+ChڋȞj";;Wr 3×eOy*+壗Onü{6EOt]q72Dh>n|nOaJ  X dU؜$6XӄZ܀{Tx?ffq&nqhp>&[N8P2#VJP vۿ, FW`G#FI+`KWZۛe ]νm5˳lYڀo*@5l5 tf7v6*ν\Cߩ6'{ڠmPnE?oG| ;R%)JBAPBDE8esA;e!SyNjԍSk %*͈cB6Ӝ4yyp1\w[y=o ӛZZ{ɸK?hkbF(|4ި?piZ>= U4*Ewɢ[}*tv}Oy֍0)1z-qN=s .։QCzf_ ylxEh*=i #Kpvŀu.vP*h/0K2trjYzlTiĐz)$3OoJlqBwY0M4y$;47-TH`x2\Z4-'D}#ʣ︄pucn*3}3>ꑧ(1z#HD; ²1 ˵ "UF/<Ԛ&y6}?k37}MN e,O1ALD׸\s/U3<@n$Sy:MT= 2BZ";!'^{x~3;]`QFzTrȢZ+1>:ڏw~f.($p-ZêsvJ;3@xl|=3Lx1j6JhZzysn!ym %Wχ~IxMY0#TW* uT~\ zØ ;RyvwYm*;,O?jI5[m.BUnћѴ ` |+&)"+x:͌X\EJj9;RdŁO'~{_.9#lAW$ K4 JBL@z?kR8% 'cAcjhW2nT ׳ ]NO6E?E_K֔R<= bVaAҌj ]p 5924VsFt'O~v~ęsUNժaVhl֓iTT%c=WDߦ `BB?e.i߿x*ŸVS&$ Ԅq{Ov~{:%w{Y--A<Ɩga &G ^2q\9l@ju%{-k 8ޝ ʤDܯ٭! ^{ ĺV8>E~lUuW6b!iT>@W[6 pvp=VLy2ONiY+mJb7{Hgqs=~*t|R:&\pxy4`kxDhhZƤ.>"ijwq%j;zXKd8l'd&k8ͣ&ҋ^[WlکRۈ^twp fLhr? [CR o}Aл8л:AdX70k:`m)bx)K!!7 5 kj`w*;^REYҍh^3& ޅB:?6mX7hi=ި"W_>vO~ҞS^^*TՑ꺀hӛLWV'y ^VwT)s?Jh pX̵6jE`E\Xɾ77:Xmw\,}ZM͢'#]fRfFURREKsꭱLiR5?Dhp2.1 Defv !w+zcHF~iB ˷$H&!e3dJ!5Mk5f4E{j6/BI^M+fs@w?xdK&2Bq/>6a;\/UE?i6<0XgoM9 l@X-C +C#2 詀cpTjIe0^#gy"|SfU xvpot ]c%pVUfs%ȨΚU@qEOÿ~ +3U'>ݰK]>AY8o :p]>> endobj 24 0 obj << /Encoding 25 0 R /ToUnicode 26 0 R /Widths [280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 569 280 280 280 280 280 280 280 280 280 280 582 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 575 280 280 558 460 280 280 280 316 280 280 280 885 609 280 538 280 416 382 313 280 280 280 526] /Subtype /Type1 /Type /Font /FirstChar 32 /LastChar 120 /FontDescriptor 27 0 R /BaseFont /ICHBKD+Garamond-BookItalic >> endobj 30 0 obj << /Type /Encoding /Differences [32 /space 40 /parenleft /parenright 44 /comma /hyphen /period 48 /zero /one /two /three /four /five /six 56 /eight /nine 65 /A /B /C /D /E /F /G /H /I /J 76 /L /M /N 80 /P 83 /S /T /U /V /W 97 /a /b /c /d /e /f /g /h /i /j /k /l /m /n /o /p 114 /r /s /t /u /v /w /x /y /z 141 /quotedblleft /quotedblright 144 /quoteright] >> endobj 31 0 obj << /Filter /FlateDecode /Length 322 >> stream HTQn0+*HREU)>Ԥ;fI 9ﻋi"agwF뱬{M _`8A۹&8\E8sftvZNj{Ap'@k!ߨ8N [?Kh0t cA&HVg#?.c X ƝtTwkׄSk?M3Ih`b*Jҝ&?襳vѢ$YfHD(QPlXD$O f&y٣PmNa6Na6c"zlP/wCs$j%~9_Nsx{}?x- endstream endobj 33 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 8607 >> stream HTyPWǻ+0 ؊==&+R4lr svOOO E4QJjgQ1Oh.bQ(֜$сZIVRF2\e iqcp/2q~;s{k$ ?Â2_ m .e'mݑ/edqH )˰:C *[.:0(1;&d& gGAsKlDpP[ZR(醇S cH|! |&p*8i(>tP‚0R'P 6#mGᴂ,Ig';*xCCPvǦ;Fdc-Z4EvF34騢=5Fmdsv|Z?-q7db oo2mM,Uj>P#No4;7mHQ/>0rh܈}.Zҫl04VO Њx} 4'jLzMb,E&=я+Oe߾SbټNW(H^8tRő}6}ȕt(%܂%DGV =MVi}[1蕕M}_(PjSU'%}/ebD;/twp|=Q;C4F JkP s5$Zz m0Yfz@.$}VgM5g5PH|An d=AAnDϗ"+ڝUS66mtG#%l[󝶖s.'j\?] Ùmdm+pfZMG)kTfYQwn@lG]}$;Z:zPԞ|(ws B#;J=[u3$($>(#zblW2$`wGm(n^ wE \t}h~J7QleW&Ũ#G-n+حײ"3_;>HQBzafFmrX݇\+> %=[3d FɊHs ՟n=L3BG ^Anp Ü GsVX澯k(vI;pH%ȃo25&cݳo yoލv3zBݲ7y|T[LNEA*<ŏ?6;N@zXVsQ!cG;Yh2XQdFTeR 65$pzVkfVFZN VD]6!<d'>!b%D'O"r]M\Wx\% ޥR:t  6<c06/ɲ$[+J%OVl{LB 4I4L^GBk{|4x#oF}nk3ٵ[" ^&{QOf9T(H!ɺb@.Յ!nC?EMXV+/.$I> + ]n>y cU-3ʘrEǵ}Sk\;Y"@ű${s9æ'_Nh9'H؜Ē9 <<Nߎ?)5H7pG"嶄G~A;-ytOlsb#:5zmV4 Ylʷ>(wz=lci}i9\xUdyK Z J#מªoaє>0­)FsP{/4d<Q!pe./:}On%nKY<蕛!&@Rke7!;TK0ַdր"` wǑM\(mxVU 17pA%H n؃hGݣRwhF PI8,.dBZ/rhR%~ʦFP8պSX8 W[shC8DP؃gsK6 #uwSZ|Ў[XtA(#Oyj&S^xvVXCIdv7/ W慁IZ}5Pz4P]&fLpw7h_9z_>`j̈9\2~UX\ 4h{Dk?JN;x q&V1t߱Y\Z<\IYg5DIeLϜto*S$tj`.D]Í@=\a?G70mX= m}۾5Fo5MBkv3д\$Wuz'Y\Dwq̃XʴQO/@6zbCA}Jf2@t| 4 kGS X=j<]'-VwǍlnQa+lgqIC;wC}1&X}d DN(+=6?|->j)\WA!] 8OY1T>t䎲*Wem*e+rvQ|1hZeK2$_t˨v73!HD  .K2ytm-l{bdO7AI-6V&y_xDB掖/7j9\Tc:c3qo_ߓb8,ʀٍ:&shMz DR4?צxN O%%qdg}}F/@&H0_2˦0{*Sz-LǓU $rtcIxlB~]'ЌlQv{A:ZZb/bdq3[MWs7Q뗪lyF> e[M,ѮZ/Ȇ͹Yr%tx7qБ8`/uqB齁&<Ӧ h&4G0C16%/JiK!mb @x&@JLJƙt.z$i{νgr# M&2A s=aH@GlS?#Fbi9d,;7ʲ7 3vP&4WMymt50H42̍вW/]Ӏ'#HV x:T cZZ3sp*rYgʜ@ .*h )KKhJ郞vQ%E7 <6VYUyE7 a^*c*D(TI]~n7X75.qś~bqr}/,)ƪ8WBKCmSAS#=F\k\-B#Ә?%OkX(xpQnTOa/5nW9\X*vnBwK^4}WȃѾGjYBDeUQ6x#ŕpQi)K_&̠$GSR ·V]̸a1^6~a]=%nZ~"VZ|NE<ØOUu}aӓ{ b,% zi`+XSKҡ.IU ^H!XS~:Ѵ,h,'7d4*z-޹ƜWfa"eSPG ۡ% klcۣ@oi)Uihә'O-uWƐ|t:(T%íQ*>Rsf\E/"r55z<BPX)m$ncω>,b*<<$OmZG4~M$D,hwT+$oAk}*S={&49_,զ@Y?7#jR^h8Tn=5w(Z[鳙Er{"fٕ̔9J4+00fb_^,yݤ'SES=t / x7n Q `}%?oKu@Y <,,5NOUb*oSb%YאMz/g u})=(w.݄2;DKDJ/Öw1n1ˀ_<7eưp@[uqc!5su4dȟKO>koU"3Whe_1ZD$- N%|xWCiN@㫠֏oT&~O]9%QpR o|mae7 J9I/PЄkBP.]_GѢ]kB Ro-C9?Ǝ^rYH4JR۲9%a]eu0 *>˪.IpiR׿:":yh7"dz~RN~vL{ژf揂q m \p c"S~׎ i)Xm'Wc}aK URC{=Į XߢnOUpzLSC`yM۽Z;_XM3 GPNGQ>| سse]G`YaJCVĮD(\kH,F!$f+Y1‘$SyzecV{J010rh"dG@I'gX"KH['2rl؍'f`-gf DX 17j7l1_Xҗ5)sc78ݚ1w[f}ˬ8  u ;߱"^T#wN #z+]JbWy AXwEoۻ$) ӄ.HA)B()ha֔rAڰ[.byTU")7X:~…y4W9:Lz}Wd79Y̘c_.r3 kDF& `oQnئxz!#ѐ*MVT)#!I!"M۬4$$Uc(Ę*t{.u3,h4 ^4l` Ύ)m=ȣk= J) b.n|+Q^c63Q!a%Ə xX>sO#q{o/B/S;[iXlDlIgwtdXJI T?Qh:A]Ep&Xٹ"w8DLjX8s1a|LX\}R$qkt@)#b(m[֖סH;QkK [G[ fd5.hHd[#2-[8 i lPx(O7lS]1<*빢jcMǜn* NutgE"/!vEԲb|[1߯LD7ɸW#ME@GSnp,qJForsn$QW.|DMÄhtP)El"HG&rq o=ڏjw<ڟ8[[Ys3v^{6o,GD`r@A[EThG׏ Un^*im;J]KͻZRhhvK'R:Q0p{ĺza%,jx 9fؓ&i\@bTcb[Vjq٧gPHU(-S-pT'PXr5 43Cr"ޛ@s|0 MּkA>΄[g'OKa]$XPYÃW냭roLy>Ϳt ޔq3"]G Yӽ`kz{M뗚9&R'les/^T=LNXPq-H> -5ūWBm^jqeLٴDw|0]WUV\2jܤ^`)]%.6i#I_7ywl{ Z.%&õ e"?) endstream endobj 32 0 obj << /Descent -218 /StemV 97 /Ascent 665 /FontName /ICHBID+Garamond-Book /ItalicAngle 0 /CharSet (/l/comma/G/zero/M/three/two/U/t/y/L/P/V/d/one/j/x/parenleft/quoteright/six/Y/hyphen/c/D/i/m/s/b/h/w/v/W/nine/a/g/period/k/space/u/J/T/f/p/n/parenright/eight/A/E/O/e/z/F/five/r/C/I/S/quotedblleft/quotedblright/o/B/four/H/seven/N/R) /StemH 97 /FontBBox [-204 -236 990 835] /Type /FontDescriptor /CapHeight 623 /Flags 6 /FontFile3 33 0 R /XHeight 445 >> endobj 29 0 obj << /Encoding 30 0 R /ToUnicode 31 0 R /Widths [265 265 265 265 265 265 265 265 358 358 265 265 265 218 265 265 530 530 530 530 530 530 530 265 530 530 265 265 265 265 265 265 265 617 579 645 711 528 502 707 706 316 325 265 494 807 718 265 547 265 265 460 589 679 631 933 265 265 265 265 265 265 265 265 265 448 555 493 545 492 306 504 565 264 253 519 260 824 559 546 581 265 367 393 321 549 490 803 556 480 442 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 418 418 265 269] /Subtype /Type1 /Type /Font /FirstChar 32 /LastChar 144 /FontDescriptor 32 0 R /BaseFont /ICHBID+Garamond-Book >> endobj 35 0 obj << /Type /Encoding /Differences [80 /P 97 /a 99 /c 101 /e /f 114 /r] >> endobj 36 0 obj << /Filter /FlateDecode /Length 257 >> stream HTPn >nh TmU)>l{ς"5r@mccyOCkf١ApW'.8jyJKgSoSk`Ż cv)tڌp8ѭ~CM OO}'GK7P<ǘ.z3"*k@ Q9vA~,DGLppI84"LQ]ImE]QQ]'UW&. t%Wq\fth}نe N endstream endobj 38 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 2806 >> stream H\UyTTouDy"j!#&\Me`DdG4bF*M[LPn؈X(ms<ŸT{x~Ch*F;3 Җ(#G*&N>IsX%*iw( 9ledgV3+)Ǒ2FQVPJ#ۑ}$)9YI)tŹTK[)t(Q3):4kNKIKJsdz F(zaNipA B BVHƹN'klimDmnn.EWҧ鯊r+&Ӳu!$|j==+<U]?x^SԈ<8^-TQOKNGEjJ;\X_kjݮo-{ )r)򩶺 =6-N-t;RS7g` }DK/`/L!ohlHkZ>1qcFʹvbsxqKMV1:iTs] wYe3< +)c4W`a9(6fTV5zP2~NጶEbT."uaf2xc. >w ٤w|q!Hcֆõ.n"Z럛n}-XC+HF^;7=)}☺\H& /ʙcfF˒AfMi0fGC3h0vll\Nj&IJd婿{%־A0.sLϾC`Bin:[F t5JAX^ o$7N}k]uj#$W=DbF C5',ƫ ќ520k+gnhN<nFfڰ4DmC(y#"|{sU* ~t-܄ yRܖ6lv.:ڏ:sm&מF% ̨bJP(3ds?_8uJyR( -n}ypyorR/bZFsUCnwd0jKm"9yڳ#"[\=PsԯR F+x WW&ެfTO$S7=cF7m=6jmS6_,;-|Cd:*ս:ta{cc"M`^86ط;{%zpqf""f08?T҉fR R7DB[zuHP;DH3lv%T ?P>xKzu ?GO̡5ٷM7̇.l.w| İ33IIO?:޼`kƖYal3Y:A\LGUKkӯXaiSk~pS rV0^ii/=w{&%KCb#f$ RaAFf5.`AOq -2ǍX̯{Q&sX(QURzO[T D}];QaY,D}fG@N5bUr~Ē_XUM4tR,r ×|B@|cƫWMa5߹rb`#_>[Ú7W6Zn(%ӂb~T0(O!pRGDuY!MEaإ7n*[ܭ6Qh,͑}LJZ 17 SY )%JAZ_+e20%0nEgsq?9y[ȝ~EUx1uڦd2Dk9t_ِ͢8$o?ۗ6ս(€axIqSIIn N ' 3onfm </1/bPDn@SAb4KݏQdϐrx #c^R% EE=r't)&C"$fU$h깆z3X3[1՘V%2! <}/mxwg'^篖V7j_|G3Qn9bB82eo^tpIA *\Dr!1$ƴ.!2bz5$24tDf&0x.uϴIhÇ{lyt`EwVB"q:v϶67Zea}ZɢP,tm.F Q^wBх> endobj 34 0 obj << /Encoding 35 0 R /ToUnicode 36 0 R /Widths [667 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 278 556 278 556 278 556 333 278 278 278 278 278 278 278 278 278 278 278 389] /Subtype /Type1 /Type /Font /FirstChar 80 /LastChar 114 /FontDescriptor 37 0 R /BaseFont /ICHBHC+Helvetica-Bold >> endobj 40 0 obj << /BaseEncoding /WinAnsiEncoding /Type /Encoding /Differences [19 /Lslash /lslash /minus /fraction /breve /caron /dotlessi /dotaccent /hungarumlaut /ogonek /ring /fi /fl] >> endobj 42 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 10007 >> stream HyPgnAig`%2*h8tWP9XwG("k]c  c0RrEA JbV`r=~=>(XnKUy}?'IDb7` eUEfԼBHyD[}.S|e^'ENb֖:ES/Gcs ꔺ*CizeY^ܘSeSǔoT cP.T"h4䫫9c@ +/) "B0D"DD NNN$ur~4PjĜ,l{/o"'vg)n.]:]^zF]oN-wkp;6wozxX"3Zd]!SOܓ\Yfm++GV|[n'udy[r~I5RR>jO}*}}F|j,޴Φh O\q).:_Ė&/b}aȓ[-d0XX@^:NKlҜFZD#Eh BY ZFGuUrZ jȯ}F@H4Gn.rSQ%.H1Y[5XF  d@ y [PQP#%&0S^͉: o鹹 3$ee%pp~'|U(@Hh|%W(8(6#(}ŸM'lbƬ β&+?a6aRȄC=ty% n!'/A*Ɔ6 n C 桝L !pC~oڡ؞l'e=LNlYUhmf}3<ۆ{!UYmа VƎwO1v:sT3&s61Iơ4Ú'9Q,' gkqp/*'s;9djMy*h#V42)BZO(@oQ%=c*Xj ) `"'h3s3+[=6AߥC"w n'Ӑ!{H@aő(Zj : KPxӵƌ-Ʈo 2x}c¾;pZFGUS̎of 3dB7QƏ>zthv\"|FDUѴmT3OܕTA%pJ.mwTo1 %\Oo$$"e8.AVYVKJ|c˵LK֒lW2(-i1؁#ƓF{x6-Y7zm𥊇g*dX#+`d\c BdJ^5odnW'2Mr2¤0"P=9\2Ÿڳuh 27e kR2e1d*`pNOE0c _Wm4PB ߐI N'x bV^މQIEh'Do 9([P_zmY~/II'˰IКf─"0ɇ] ">E]zYR@_%f p8Ys%'-`N/Lڄ- z_=l$+wnws5EM ~8X6ߩ=~QEbҲK:H%d{B"D5\,hc4'qRBUqĸS .D3Q`~ pajQ6衸] b@Ds 뛲.Mnj^4r8"Ypg6t5LdO:J,S6Dm+@6DG=UU*K )8`;㶣M|$BorMTrStH~fr~atK@%*ݠi[E@Jv]3|Tu w.=EC/ RC| y3I,pי6ʏa &hcȐ02_*̙?w̚`}[l姗{u~x .?m bt.(ZQ_,4- 4 `DD@j5(AB " UBE nfNוViwN;;3$g??U?Orń )ʍf0O@y\y\FĻ Lh7C(L0%aBR8/ M ^uSi{Oj)c aIT͠Mhr4 fhOs/x%<6/T41 !h6ާм O_iA6/~god&9Yb4+ Fl4u]g;I\sd '˵Ô EZ0^M VPOw_Ma}_ֳyIQ | G͠<J* h9B.0$y4`0*41gqj2r_30r%f %1񣹾)&뉮0@q:Pʢԝg%\A;Ds6,r8@:fhV1zٔ|Ea`ptcLoQU(ʸ'IEo3'>SwS --Ho Ѐ+/5$@b%,0_|X8ߎY\ <W3<4ިDߴEgjh%&&5**1蒷drFR1|;^*PkGSn" /uN^HP8Y 4CTO1aT# 9SvYijE![oySyh_%c6?n<μV mveY'ђY%F)e{WnShQe _ @Bu*^BUL0lx>Ć`7jT강u25xtM^>.1AKĽR$&[>`"ZE) \{8#/ÊJ%E)_|Q{a铙ⵊYš`ZZD>x"aӉ%$D :V]ǚ,4ؾNxDل# YEߍr^OEP9%wxª ,Q^*+>-g* ق+Tdlg;w1 {Ų_9 J|Ǐr\l@X %SQG5o2Cۆs٭ObD:wKEW—zK AJ=IJI*|[{5B\kC4mp…-MlEUEQ;O+*P(k$0VTRR\*mS|<*3psqq"q$ s\6G_1VMȻ\ F h\Ry`||r+2ߜe3U7` 1̖`tFJ 3D[|+(L6'Z(b7bք<8•VLa-R1PF9TJPnȰ$] цZu\)LS?PKN4E6QC@[QwmPJF-_Ӈk2NJaxmJ5bG0̵zWG\l>^U"ô^#7Gv4Fd! Ӌ[R@ϿJ)@Zwqč kPKx\:K?$J`a_Ȋ6>.JLĢ[e۽mgg@0c[V;db2 p:,[sxkK m|\=XA*x aPB0l}NM͇,egӐE7H*E2;AB}*d*h*ͮb`D2(7 {;~Y@=i XwW3$AfxgdVmQzկU_2} Kea2,$ z醽:"EhlY$oV_a4,ǚ>,r-''0Y`V2QA162oԵzZTF]GS#h`+/W^^M`u]CRm \{kؘls!|ھ/) b QϾK6p5+mE~'tx."Osɱ2yj9b?>Pުœc[Ԋ EǕ'u3@ހ,LwdT nDJņfЊt& K yA9XeM_a]vpN4!.k+[ZY8%u奲ʿWhۓ'Ȣ!l̅d^ItStY:꜂R&!)[tdyr=C6ޫ[`sRӢ-B\p%]WF <=,uPI.Tl+{ke lOU8Yj9n/ 7ŭn<*FK# -X`.Na2T P9A j ) UEŸ1:3qSG.,a|X^r}wιs%w+(Dǯ$_@ Ԭ*{YMu'R~J+^džD'mo fc/5kbf5L+$[eS0W5:1q>6Ҕ;d0Tv,\JD}Őf:Ϸ*1m\Fk3䬙\7LfC'*" 48ÑX<%xJ,x(/C^~+ wbD5H"~Bǭlz)XԆ6.'.hLu* v=hKQbbf|Y7óɞU !L@ؐ5d0`}njΚFhhQlxgIZ:, : QC:($dn!J<QQțf&oM3$\:gVΓ!ˢZf:?f㺅Zg_9QTn/lVF9՝ 24gvÆEz1G4vS3C. :㽦ڭk]o??mχ݉t.8{)^R&/eR^*6](7F-A &75 kҍMD4rɊ]^S\^S\^S\^S\;,#^WvD%~> endobj 39 0 obj << /Encoding 40 0 R /Widths [222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 389 222 444 167 278 278 222 278 278 278 278 444 444 222 333 309 444 444 778 611 198 222 222 444 444 222 278 222 333 444 444 444 444 444 444 444 444 444 444 222 222 444 444 444 389 800 556 500 500 556 444 389 556 556 222 444 500 389 778 611 556 444 556 500 500 444 556 500 833 500 500 444 222 222 222 444 500 278 444 444 389 444 444 278 444 444 222 222 389 222 667 444 444 444 444 278 389 278 444 389 667 389 389 333 351 222 351 444 606 0 606 222 444 389 1000 444 444 278 889 500 222 778 606 444 606 606 222 222 389 389 606 500 1000 278 722 389 222 722 606 333 500 222 333 444 444 444 444 222 444 278 800 266 389 444 278 800 278 400 444 266 266 278 444 564 222 278 266 266 389 666 666 666 389 556 556 556 556 556 556 778 500 444 444 444 444 222 222 222 222 556 611 556 556 556 556 556 444 556 556 556 556 556 500 444 500 444 444 444 444 444 444 722 389 444 444 444 444 222 222 222 222 444 444 444 444 444 444 444 444 444 444 444 444 444 389 444 389] /Subtype /Type1 /Type /Font /FirstChar 0 /LastChar 255 /FontDescriptor 41 0 R /BaseFont /Univers-CondensedLight >> endobj 45 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 10094 >> stream HSiTWꢫjٚ@ˑD$"4m7@DąEfア0Aq6j(8$slg[d 3g~̏9U羻=s`8+S +61Rg.-%y/'O*ԼɒA!pP`nNXlʹ.|\\%̥Tͥvn~Yfزy<WRMns6l \-(m<ܖg.Ͷs|2Ky%XJeUaOEVFa1X>vOįI%5gOd:b7qw p*rJ?&12ws-t]뺑S/M_PN<ӧfZ"?$AWHT-|hK跆&CG<,.1h5Vیm}.cxxq?y ć\~176~/?} # $1&i)ae7-0-AjAvK8X)AFwX>#GvO$d ~.BS]M!W,B+VxW@>x$!&"LE"'!U:LЄ.Oqd-}#"wHH-X4,?gasݶBUx#RxOXi l?v<> SU$}gXGԵzK3{iVΡc~\TyA& ӜVW=޵ 3`(w(^XЏsߔu\^!iȥk8iVl/\5cS -=hLđG6I+oÕyhC v6U $!Xz~;*$'n[". pDv%"ѱ'`b3%THl6̺wy6r)\v:1sHfaձ#>g7//^%t@:~fQ -H")Ano0(Ўmfr;(D.ӈcH;9A "/M".t;;d\C=C*Q eHׂ.^)j&Gg#@ *T?ltӳ" ivKC)|Ӥ H+qH͟40Ma6h6#Bb(yțzKA;ߗ%˯ċ9q@ED~(Z^Ёt[".dH%,(VwԔQ))zz.i#cI"h0gLOGρ㇝Ǐa, eEgH#`FO< s=G!\3Έdtd mE*DVtEh(/)!S|ANEO :ACt7m_n75?)ya?"Bw|nv+Eݹ5& b~Vj$D*P ,r7eV(A9-"Ōk+by@ðt+Y'/\qYaJ#ZO\VYmKmhlj[ C9Ek['gaTG|e15~p`g^$ªZ2bzujYoCoik zֺvtn{yz#+!%1 $JB8 s?c QtH- AJ|\[45nd# ch ݍf#JyY T Q,1fA!6F_QrA  Q>#FsRFf.t.K={*1y6u5lSZG7=`J{Gۺi) eQX0H N6I՗p"~*3:$oɇ_t;efW+R z%m} `B0U8GZ=}T KR oYJm39 ۓX*e䎧4k#iOǨz ,-HF~z NUc8qazl-&ViBwo(\`r|kPn^S^WWpvs5ZA 7]$ւd$W ssE;eap )۩̧l<ςUHzK;sb|_Y̸Mw朔+U_k҆3X1K{~7L'hPp`.Am7QI;@%~tJe*_BYBEU@9k nҲYTj0&aYJw1ގ8c69?& |= ӌj$C 2T2h(Z xe.xc;lFV^=hM5 $K$ yFZX>푸K] jKA$ɽKuI8F7m2X' fa,Ҵ{=7FOE qMĬ!a %#IHwSjR6b߱;!0 Ðƛ:*hR`a#%v~k-h&RIҍAN0^䛨ب\| 3\V ȳٚh]aywXHMk?6b&/L۽|ܒ85v8>2xNyG:c8.{[{`s> ,S<PLxl0tbwS"'%^93U s=Mo*P[W7 ,]dw@Jc,wW"E!҅.\ 8@~ʸr=x>:+ %3+)E|Z0j. 1FbЉ =:픬qFe+HDVAUz.Z r~> {y0QTY"0Rr:X'Ou!U'fb0: EPSkOr#4Sm|tH/5~KO [ ,}p1SCyJz)l .-P&| XH-}HLz;q:M@*EU OhCaP>'O̝\k0%o@ޗ^R\,8G΍X$K2򫧨6$nݚ^X/UW_e%=dy %=۫/獌nWln]Fn#C+AYDoh@8ӹu:833!"bgf,UGcEN8iy\%>/'R(^rݑure`o. 1ĝ{LpKM$a7Ry[cgo7*CSVLWyt@ܘiU&͸.-e27qL=|3ws0j"`_MFF=%:D)[>^tϑ,+MuҬL*b˄e^݌1Wua%LibHX)!l[!z9Ua?/vyU_V|߾׸]O D+ 60 Vwl>OHY#k\BTKG5VjiIY tbOITI ng竎 w"+ߥ&뷏G…-Q&J;ٸsܨ=ҲqZ :W@kF PȄ1-% M<yGtLεP4f撪F%VL+u Uێ&ܒQQTu|Dq$.-#!esTbLf\*hCUt-W2,Yo/ܺtcȲldJł","qWc{Y@O` DUvGƚnqHhG u `vާJާ$a z cyds`+IDc{$lV 3`d`:@#1I2[M?fxEqfaƶ{:&f&%A.(TATT( *(0 (^x1,rz(" ^F]VDq䇭}ànV6U{> ~ُ=[\^/{"P6'55|pOln%! s.rb8?Fr1bv+#7kŚ{T'θ480IqL7 ORSd$3`Ij2=(NOУ4Z]#ɇJC/Έn?}| n,fz 5GS8^a1Ay\iod:4;l0}!v@uCDc)a/a81 W3duMu/Qh١SN1\OD:`1?XŽ uc0NCKd0E* RaBK܎]cl`a*I˔1|ۧ |AKf?`5b[3QL~KhkhK$%M @p!t- t4 sԹO.E}7P=bJ)ؠCuo|`һq?ᅩÖz"&*##BȈ۳\1#xlM\cX(3;a]W%(QUrxhIܠN[)jOo \_ j`mnLKVe(B㘅G_C#`1INARG\2겲j|e]k(,0CTṅ<?uM4Sğ[[P_8WWwraBF(hӌg/ܝuK*&,RmGow~!gԽjOl)m5[ {>Wsw_!լ D*Vo+66 t'|nz4_̠Z[,kXDa:N1 <ٶb9. 6Pf),!xp" Rfs "!"m 7ΗZtiݿL:uݱw6zNmy+ LL>r\z&8Cbg߳P 2,UPyU8!e]SJe-tȐy`r 2rlǐudaa!:Zr FR!jHcæ N~4"#ɯR9=*V5,DZ8pOD/.IUBdF_\WTLJ.P32n?>+';z9e; HӁ~kW5;}M(HxtS/SA  ]l8F, -'%ax2mY(ΆI&|C1{+%mڨ=Xt6E+oСM!^4j;gַߍk$CȐc3`)׺V VͲ#HD`b/!69"=QɑLwNbl8pNWß?fJ^[cS$E'n{z flq vrZkg5'f_=. \niZK3G3o0I}7+CxiIKhHC>zWJo{4:[%F3`&r)&VQd ɥjt rZw!nE+ F}Qx1Lh50s+1a܅KqmC3 2oigvmnn\!86mJĴ [:fcsY˅ i;}^CF$YV['V]oж`:S4>U?g#k=j '2*2:HhiR]_X(dCژkҍz}^nNiT DW,/g~}RVvNd o5բ[8.ÞȍNE Vd"VoJxΡ+{ u-Dh< UPerɳϘEբEc<<#6^`#ewtԢ}9GauW%@w]tPL֑@i-3ieϔhIcy-ti`z"ԘHouVS&5, ekHa c lEYT #Nwà\G#=F !Yp jtxBIhYW'n5O go֫=&3{襲;j5ַ'VLsw[@hzhCz+>( JUJ_M(6YR@{ YAGWRfsf~̷{,5?,"Ǟ~:VRsh$]UVWn/V6X DcIDAHH#XYUxNk@Dfi~peʪtv)OAlL{Ȓ OLqm5e}nఱl'\ȧB "1($`<<8նNӺ\Z*A%tS<'Appot^UVg;$u!xyz tAubD@ 5 3=0$kpk7-36.~HOw74ڳlY6{mx (dV_z]+v-,Ia~ '*f֜9> 4s欍.855 Ưkp%ݿm/X!#M/8&˄\DޏVlڞ\bLү.^#)g>3~9fG9_Ϧ谥sOf7BQcJDK~}^V}-HI0L=Z$:&o^~RބS 'ns0ʧsAn5(]ʙy9zúc+Bi]lli-_P;4$9˭5$&t NwEa .2].**U#̺ 9D =03 WuG׶g5z|H)}yM!A}*X \1^9|NW^j`kG>S,P<،KѰ ,dU%N̪JX~oB%Ъ YɃѪ u%{Tw<;Gq=`Sn+JIO`,C "!-d!YaHZ6ehUSP2~)|EAfSu{xNby(hUS,͛2royС^Ar$Qp Q 3ӆ endstream endobj 44 0 obj << /StemV 141 /ItalicAngle 0 /Type /FontDescriptor /Ascent 722 /FontName /Univers-CondensedBold /Flags 262176 /FontBBox [-83 -250 1000 969] /FontFile3 45 0 R /CapHeight 722 /Descent -217 /XHeight 505 /StemH 87 >> endobj 43 0 obj << /Encoding /WinAnsiEncoding /Widths [222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 333 333 444 444 778 667 250 278 278 444 500 222 333 222 278 444 444 444 444 444 444 444 444 444 444 222 222 500 500 500 444 795 611 611 556 611 500 444 611 611 278 500 556 444 833 667 611 556 611 556 556 500 611 556 889 556 556 500 278 250 278 500 500 278 500 500 500 500 500 278 500 500 278 278 500 278 722 500 500 500 500 333 444 278 500 444 778 500 444 389 274 250 274 500 420 0 420 222 444 444 1000 444 444 278 1000 556 222 833 420 500 420 420 222 222 444 444 420 500 1000 278 860 444 222 778 420 389 556 222 333 444 444 444 444 250 444 278 830 300 444 500 333 830 278 400 500 266 266 278 500 550 222 278 266 300 444 666 666 666 444 611 611 611 611 611 611 833 556 500 500 500 500 278 278 278 278 611 667 611 611 611 611 611 500 611 611 611 611 611 556 556 556 500 500 500 500 500 500 778 500 500 500 500 500 278 278 278 278 500 500 500 500 500 500 500 500 500 500 500 500 500 444 500 444] /Subtype /Type1 /Type /Font /FirstChar 0 /LastChar 255 /FontDescriptor 44 0 R /BaseFont /Univers-CondensedBold >> endobj 46 0 obj << /BG2 /Default /SA false /OPM 0 /UCR2 /Default /Type /ExtGState /SM 0.02 /TR2 /Default /OP true /op true >> endobj 47 0 obj << /BG2 /Default /SA false /OPM 0 /UCR2 /Default /Type /ExtGState /SM 0.02 /TR2 /Default /OP false /op false >> endobj 49 0 obj << /FunctionType 4 /Range [0 1 0 1 0 1 0 1] /Filter /FlateDecode /Length 20 /Domain [0 1] >> stream HN)-PZ.( endstream endobj 48 0 obj [/Separation /All /DeviceCMYK 49 0 R] endobj 18 0 obj << /Font << /F6 19 0 R /F5 24 0 R /F4 29 0 R /F3 34 0 R /F2 39 0 R /F1 43 0 R >> /ProcSet [/PDF /Text] /ExtGState << /GS2 46 0 R /GS1 47 0 R >> /ColorSpace << /Cs8 48 0 R >> >> endobj 50 0 obj << /Filter /FlateDecode /Length 692 >> stream HlTn0 hnzk h ۴T_/;h# Cћ,oz&okyi7% yCfs5)ᯄC4;`Cf6#HrchQGH'e*Q\wsz|"կEnӟK;xR7og g{pA [QQO; Ҭ,DMnv\5X5>70*3G+9r(vA;KIUpQpZE<9xdEG=(#8;r?G;T J@pÇ3 ۷Ɣw@fIL%5N5&?'S,K",jor,;IF+$AJP#Q2F ȩ^VPQUOWBN[w*V>)JM%9Ū΄P΋Ceq[pHn8c,(7)WN,.]~=lO O9f!P.D1K /9^_b;.F:u8 K,]θMKbZ*?r^!S9uYOG}V/ː"If^lR! +:-՛Bz &KDytқ6fp :o:Qhlg:X~{YY W>$ 0D2 endstream endobj 51 0 obj << /Filter /FlateDecode /Length 681 >> stream H|Tˮ0+fiW ]VEv]2 5vMؐREHc/q.+Gu"PVm\{X5xAq7~>3-cv?Gy4Y#{2jgUc?KuӗMU~L%QɨzÔ8w7/_hcIwfƫ+Ej`*Jqa NM"ko@[Gԑ_Q,ʲjyÑ\S/Cd7'T1[SK,+jB'c`'%mTx@'Ld?³!~KH-ZA}O^tj~T;  T?w:~Mz}]Du=^=c Q^5y8sWq=G)T%B?z\NaXS\ȘxhpєBw}]P&oߚm1I{D> stream HlTM0W]$!Cܪ=8Ub#lͿ<v(}̛CtI4|~~l,ͲS o(eyU͈XD 26:A&Mzs3r'}^ $7|Bt+=Ut9֒.y7 /wJ&ĝ%3kfU|0 (A:D^leQpt\-DmXXȋ0n')9o3gazZxZ.·X77>-+y-e* pM[`lcRUgxg%}tGBp,]/=> stream HdTM0WB1 _Jm*U*jM,a&j/ LyƆӡ,Sٳ7a.3Apq* {f\vcTn-S7O`4쬝qSӍ=ZkSl3;;[N1Vqk7$RjV+2)S(8GI‰΍=Ϩ-l6 =Hk]`1ȄpzuV sEZ'&|HtRm2\a]xf+|0.\ aA;K0 ݭNZx>GHnʲbHOMb w9nuD݊h=c5zUNt,{v(ϩm"p%Ы^8E1Pzof χ뚕)>H}R7%fL۠2M};E0!kox,I5Y tIEF [+M z)ِWUW:>q,EJyE70i{rpˈEM9|^51f ydeGF[Fyizz¦{ yr{]_JG0Urt(dT :* k6=}(g\LUN)qC`/Da 0m+n endstream endobj 54 0 obj << /Filter /FlateDecode /Length 672 >> stream HtTr0)(ub؆cVߚ&Bbh]@?ZN_Nm;t.ܤ~[G%7m.J˂U/ ekE}rסK\{[?e@#FΓ Te@Zm^TOWu> 5Dp0I&bdhUfmd7\Fe>^׵Qަ Uo4@p#U{K2gEB{}^yZ/7=IR8ULbc#%S0\߹U%?9 *Ay:7z|oVߊ0TdU[7G0qØuec`41YGOVKL;Vbhiθ˔ߞtϻ?fwdi &YV+s+'߯I\t~> stream HTM0WF;G"BBāM(qJniE qBU͛ƣH\ʦH>FqȪ%YUЉռzʚGha܀i9oq' ̯Aكk#t Pլ#ե}Ri*H(".-{yAK*, AGN1T<^ĬKa"Hґ?H> stream HS1r y0A`0.ҥ':U|?+q!JZi{z>qEO#⿉WZ ?q5:+̩Ɛ05`x{X|uH-OQ.9W4jAVWM>²٧y+$>+FO+wH!rxrR6;g,NKWx>IGRq`eYxzCSv*80tЌÃ*6{wW9\b6E LCR()RNTO)b1FC`=?ؤs$\i[csm)$`u`*xCGu!Go?ӏɿ/>'0, endstream endobj 57 0 obj << /Filter /FlateDecode /Length 249 >> stream HLˑ! CDAP|h]c A3޻=\)~^smĒidxMZ2$7˜N\\Y&\o[ ҇|ýY&l]P_zxZM9,``[.RZ.VJIд} $L<^GTTC5\OZ0Fq73cyU]9:4AR`DR6{/rG6 endstream endobj 60 0 obj << /Filter [/ASCII85Decode /LZWDecode] /Length 481 >> stream J,g]g+e/h_!_gCtO=0f)$P%cIi8Zdfc5&3j_8$7g.@L`YKUJNGBP\poR=_;Dl'P(T (7Boo^^S:71(MN]ZQX/+Cbu.lK"p74pe1T%s.DY%&\1TdJhr54.M9au6>79n6`Q:4 PbLSZTLEE(8E@'*1mg_*eTnN*;*'V3+gm-EEetX%;Bo$ur2ss*N`.-!.kG_q6GDD' dKoL!8Ka#EV,@V!\j8ZFbp6EE<9cn=N6j0nf;(&;QU6bUD')c@\ 9-d\DA=cZ0Q>gIM$$;cd2O@&a;X,Nn_aP(]I1aRc(K1^ue> gF/(+GaKo$qneLWDrQ#;5\S(\$q'4Q,85`-8;S(=Z"WSBOV*FM)4,?B],R endstream endobj 59 0 obj [/Indexed /DeviceRGB 255 60 0 R] endobj 58 0 obj << /Width 76 /Filter [/ASCII85Decode /FlateDecode] /Height 99 /Length 331 /BitsPerComponent 8 /ColorSpace 59 0 R >> stream 8;Z]!CD):C#_9J0rpp&$iB#^\>936b$`+;>fefRV#UH-!"q4Ck[6;eSE50\)%&9S# E+h^*UL`!H/X]&BJlb^j&k,^AA[oJ-L1(q.i-^`N"acFGB,JYB\;t]Z%=djC*e55NlBW!oa=Fk ,jWH5CEM7&$`C+6YPSk+1"`l!\Vt<$Lnf9nP*28_8k*&L;dZ5351]%ak4u'(cB0C& S,K+-rd)]^$\dkIjA#;)MT5V_!Q&W>e[*>$F.C"^RHpLA`V,WDF'<,lnpCZB:6dfC~> endstream endobj 17 0 obj << /Resources 18 0 R /TrimBox [44 44 656 836] /Type /Page /Parent 1 0 R /Contents [50 0 R 51 0 R 52 0 R 53 0 R 54 0 R 55 0 R 56 0 R 57 0 R] /Thumb 58 0 R /MediaBox [0 0 612 792] /CropBox [0 0 612 792] >> endobj 63 0 obj << /Font << /F6 19 0 R /F5 24 0 R /F4 29 0 R /F2 39 0 R /F1 43 0 R >> /ProcSet [/PDF /Text] /ExtGState << /GS2 46 0 R /GS1 47 0 R >> /ColorSpace << /Cs8 48 0 R >> >> endobj 64 0 obj << /Filter /FlateDecode /Length 3630 >> stream HWɲs}R@J0YHeTm/T^4~da2x?$_/sn Hg t=_W/%>olx;vljz6bܭ Oi6*dw#W?tn?_g(H2g7+茶Q;e_m}mdD7*&yxM?:o+ S/XRQtveV_ǾG}. 2Q|X}U NىE!Ⱦz1ĠX_x$H< Jn$v~iR]zvUkal_'MS{2m}ܽ;_!\ہwR,Ô^@d~] $(غ"(V?nGJW8Xz) *qf@ >IړxR>+byiT&s'bX#/$}/L*;&ۡG4(ʱg#BʻgbCRǣyǔm\@h_YÖ-nsϧ(za^A # 8JdSvaF0)2ewLM2͕Fn^أ=;^}ihf Ԣpv7.aMdu>Qy#X5f ^4N[qaxNoiZܑ:𔶒-1uBo81 }RFh3u+"n+Қϩd|?)$G6 5f;`Tg,N8phh{vͧbJkREbdzA px?eE ]#*ajƒs<튿Queu;/8.T9E "}Y(> & ;ݐ9NqLG|w2z xV\쵌6zFVQ#8,%Gg~iuCrqwf G?J^"YbS`j ˎ6'?vXh$5Y7ν{{49* v{I[$:VmfFLj#,W듟(4'9( P=ΝzG7GËY$nw?fFvr4`-Ĥd 'ǴϼRzxfAM|׷”VDAYdh2F*' ko8N9k{PZUIΉ9G/o_{C 3ł,Kk˔ĕ nwC]\OLs՝I8fT=`Tc\nrI` Wj?6W/2MeU{# eY15qȍz2!FHD5շj8eٳlMO͟RD ZHAw"m7fpq E+!9T \ \!T2"*o1?Eldlg̉`f.ˬ5lH 05ܵE@gQL<ȭe \X }Kݚ."[ O=~D 8kCH E ?5]yzn@~ZBP]gIZޘbM. kJ\˚攢V8]@)Jm:WɂGkCWe.CN44H#-n+4JRb2 u]:BAYӦum}rLEVԂ7ϫ0[73-~@4LP Hb1w''_{մG.#[4g~c D_@M6ЅnJ]l 8=Ib#b;9ttzսzrtŅrS9,oq`"Ԛuh{$,K*mw}ۢJ:A(CO&*d;7} C3f8E^*%O$V<;mx<>s博2LB{i-g*5qq|0j7 y/4j ccP~!ي.c XfKE2TϨ+^ܜvzjZq5y)28j Bln;41lQyK3Q T3#SsS$4MƳN&%t5?ɻǣ ޿uOw Ìlݛ|b#%?hMDpiXpkܐM29`϶+zxSXTu=yYoC!ܚ̯ QǓ2EW.T 70ӳ2LN*H5)跪)-R3Ì!ww?"s~B`*ٗF-NfWB0[?eeHF&4&Yެ20&T5%q?MM[Л:] IYCr(,.XJ&K߼ U^Zx=.*Y^Ziϰ0ʲ:'`9ΫA6ړcLSI&3Yѕi`J@tʧ";Լ*Dj|&+mDSlkNY\b6N:kZKW,M*6ϕqEU(*0b{%.&˯bseޘ{g".#ʝU U%rEEoT.]tHHEڵR**x%j} L[H(v6Ƥ< ץN׽V>]&l"QQmgcS'+-c2-cŌ_e5 endstream endobj 65 0 obj << /Width 76 /Filter [/ASCII85Decode /FlateDecode] /Height 99 /Length 346 /BitsPerComponent 8 /ColorSpace 59 0 R >> stream 8;Z]">8"gr#Y!QC^9[dHh!NTZS#Hu>-"oupYr!ICTKj>%(c%Tm7[O,^+,?tP?@6Dc XE(pa`"h(Ap9A-CrR43qZn>?8XW/;K^[3r7H>9\ikPf#;n6IaX(&RP(.k0EQ8)\;: hV8a8'nT..MI'a]0i8p+nuLJ;WH:?LRpT_MFcg[4K(^#si[F>!pCh<((Kj%^4p7MP Z_TiUfeZ<-,;iJI.\#%Z5H8(mFc=hHkq?=Aj!aG"pCh;n0;_4p)Fr?P;;s1LrTdnk ipMMaf<7QEBmWVqft;gOrTe\iq0tnJY$Y>'-dR(u8F+^*?^fc442LEr3#[N[(rhIN E'#c9k;**"]_WZ~> endstream endobj 62 0 obj << /Resources 63 0 R /TrimBox [44 44 656 836] /Type /Page /Parent 1 0 R /Contents 64 0 R /Thumb 65 0 R /MediaBox [0 0 612 792] /CropBox [0 0 612 792] >> endobj 70 0 obj << /Type /Encoding /Differences [32 /space 70 /F /G 79 /O 97 /a /b 101 /e 103 /g 105 /i 108 /l /m /n /o 114 /r /s /t 122 /z] >> endobj 71 0 obj << /Filter /FlateDecode /Length 292 >> stream HTMo 9nP&dc~5HP` 0ü/jܨ8Cۛ4.N#\ 4UAYT|^ڴ#fI௮Aכv/̐@YB-ճ/j@S"dan,)U h9&cŵ7Xܙ$4BʼnX>8{>D>dgS?]!$mQRbE޲>(mQ[~wH/Αy]9ޖh ~o\! endstream endobj 73 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 2597 >> stream HTkPWB꤭6m>;YVeZ/mZx+T# !$!+@_Q\BDDnmzYGc{wf?ggϙ9?ws0`IvHY/I%K ~X"n`D߈U/&,z#GBS ïS_0MIRJ.?'XKh5/MmBi*QJxT. p-'ettArZ?xzHSBQ_^~MF%|X*T2|'F cvvan RcL^b0&F;Y͎u8xv|V컯9i\X>ΈLhѸۤCnәQkvMl;娧pV55F(4M:)!\s)U?X&U] wۊX'a 4F|lr.l#qYb(Fw T6Z-RTIW'*ezJP-zL&S sdъ^ggԢR*sw9|Y0C?x̌O0ۺxޥ%6gN> @iR+ꚬ7pREbJys߂ cb[-xZGty-.}e oPUv},.&=BQNS"?4Aw]'ځ51uLr;_Li:(2TnxpC7?& |-OB=h/4j?9p dFSG2wXV6+hP:ˈ͉R={>YLx8GVg(vg-c#aiT'NYR-RH->w[àtcyBgVYb&/* }&mT8Ypw4נ:dwN.{o]a?Yv7)3e4՘&2CߐZˮ(ShZޖSXnցzn}3`Y"=Vvp[Q&-NٔFp>^r4 &d_`n&hJ@['dt;N)#J _86pzw]Ҳ"8VtB| .W2&[Jezxu^ 0d 33L04>ەr>d ]jk-WWy$)h}-LGC%@8RxKd 1doդzq]cc.2`c^g@98xizw)`oZ)@8JDۚL<3]nho`IrP!}}ǀ p5o`xX&:.I.7W)lQ4TDFt\S1xu.|z§hLJ3Dnn"w6>Jz9^(hoEC> =r6 wYFh͖\I9d;KT=Z**9 dUk"\sT(tGǻp2VUkLJ'*#-ZCT+m26, G9ŗi.8=+T>San!|Fgxns/] ̂w3ޜ_  80HB | 4gWW>DL > endobj 69 0 obj << /Encoding 70 0 R /ToUnicode 71 0 R /Widths [280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 600 720 280 280 280 280 280 280 280 740 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 280 620 560 280 280 520 280 560 280 340 280 280 280 860 580 600 280 280 500 500 340 280 280 280 280 280 560] /Subtype /Type1 /Type /Font /FirstChar 32 /LastChar 122 /FontDescriptor 72 0 R /BaseFont /ICHJFL+Garamond-BoldItalic >> endobj 75 0 obj << /Type /Encoding /Differences [32 /space 45 /hyphen 49 /one /two /three /four /five /six /seven /eight 58 /colon 65 /A /B /C /D /E 71 /G /H /I 76 /L /M /N /O /P /Q /R /S /T /U /V /W 89 /Y /Z 97 /a /b /c /d /e /f /g /h /i 108 /l /m /n /o /p /q /r /s /t /u /v 121 /y 132 /emdash] >> endobj 76 0 obj << /Filter /FlateDecode /Length 310 >> stream HTQn0+*CJ)"Cj{HX]4mYxa0 ͍3@ݫyمNmq8vbnڅg$W)8qZk2> stream HTTkPg>CBl]uk[ׂ"( WH@B \ Z]lm训ʬkg:ool3_ϙsyΜsp,b8/)Ϋʫ m?(*?sbsCk#Bb4!ﯟ0UjtjM 2OHI:_*VUEE$aua0T$+矐 *c  aW`{q ;0#w,Ke͌'̍oXuNv˟:5YZUXh {1wץ&ߺ 7o< nr+/yJ%Jz +)P24lkNIDVmNCLI.,NPQEx^fɂk:Y4< NyIyNe!FD h:RbU+,%VImꢺnwը~Eu"sG#jNt eOmDkyzv&o}'rzaW~;((֧]==XgSǓy/$ISjI=ۼ0ulv3ԠQV`Q)lG?}*=no +(& /AyHOU sH2D ԎfO턁`ubJI.zuX!MNZ) ̴ gKw<%M/(&5EҲeҴ?>~Z g[[ G7vu:~˛kNش&谴h)hѕDKHթV`AecfC kDP"G27<3b1fLsI#ϖ\gV8ݰ')=Q9ܺ l/p+?9!ڂv">eZB56Lf"9=4`8%IBN@o-Y@iyQt003ӗ[yfb]Ql Ё ^a@g4TdJzXmJ(68y\^q@x@XW /˴ eRPaIt08tvhlo򪻚t~Hhi&l{L%ׁJj}NgArc(8r?/^B{¾ބqkKKUSP생_Dߴf{E_q;J9^ )П}ȑAKFI"٨&+D{|vWOG~w]Yd6^'c>wp$']i'#{3 }9_DI\XjVґR-(n8G$|4z,x}9r r>"(z hFmbzTW/NO>̮xm7_“~X/ԙahLl6]8g};k׶jǵ*ur!'@$'@$PpQA@DUׂX:2tvwNv9'8>y}q}C$Tawo Fю5O碌"C,!&c苟Nnz^w7u:|6xְhs?ޜ Ͷef|3s&M3c DR7v歹}ޭZ};qͯ8x )Mۤ'A7,Yh%x{%yh] "VI5}Y;N5$:s=Z-4E5F5IZ5z '&YU iP K.w9=Im%: j7 RoԹ;4/ᾶ6`L%#qo#|_zgSxx{|斳* :zz1uؙ굳 kjтBoXE(k.*LҒ/ÒB%.""DhkSi e?oBw\Mi?م=y|,HnP(^g<G׮޳Go^ITkgg0xb/´Wr b$!07Kx0ȩԒ@3 zUN[+fw`? /4i ~/RYy ~.݁$~+],& #AS ǰ5A4?۞nNxuж, mVI#0rtvwtu- -;/BoDGh\#u^k#f (=ec9@6qF-3MPxsK%uffXiFg+C6?ns`ޒhoVJ^HeO}Uf5bџЫhU_}D9 "K,!6ƋBR٥sZ$o[y]V\(:zK>k9o缼<t3dJ+U2yn~m]O>#EHD‘ ҬiCu^/pnv=w33r-7U5PL~MsC 1ג^Ir_Kv+2Kp^̯ɧ!2U#هX}'j 6%2, P )jl0}2Yr :^_nMH_1$Ƭ{)0f% . vC@H*֝$FEL,xH+sCe`yh =/EVKklUglqК4Br󓌈eMQh;o\mI.-'4yHP 5IdX^Q&Kr;pW2I(;GRg K "Zbn yzݤՉclT XIM0G82N>ZO֨ҷlŷ(Mٰ,xݣ5GQjj!?N=Pgi)(^qdGnDUJ Og=/ha3/ЙMZ]Quxi^[8 גx"jBPَCn')J Yo@oZcqbf0Q胔Օ5hz}9껳^#DwfKmWe{h#T)g#v죌1,_'֡uNoݒ4].~NC,ܸB qI &Gb99i6nҶDԮUlMmZ^UVi)Q;O%ܜ9gJ'P&;RcedzXB߶V<I2>>'ug!q"/.9蝧43fziZ ,oyT65Lt<6+Is$Q2լ['v1?u#ACZ{%EDxy.(Zak#psAiVcQ-_|1U/@AO5c̢WIJ[sGWфf=;='[wMu ,=&E+7/^Lbb8%QknBj&GyE^00ǰC - 6cӉnK+,}|q4:tII?, eU*P\z…'4+D*)DO=QװT%6=kp 7.8W^NA|¤cfb< -xp6X>Y-  ApT1n *p3Z͸zqklnكXy}QB}n:<ꓨ)4;?-^MbScP}Gh~t,e0n@]VMX?E@D[2Yw.'f!p ܛٷe׫6D"yB-JCBn`^f^bPvnm2rc C[{R*Ȟ0K9L M'ǁWvɚ4Y "MC~ry5I%L`FpD!hbAGF V/]%y h3BձQBv3bNRr01*k̟˟8ʤQr)pe' c>W}XS2?qtKqqeTvQU1|ﭺ6g<p]F]LfrZ>Ɋ)Wd5lf)s9 mSO3yLp#/`N/C_Bګ2 3֚`#8'~GP"ȈJ\bc1nc߯iw齧u躭n-  /j|~^⏘p>OzNg ߀J[~2 p7],80i9lFEjl #蹩Ta>H 0RkaǞMgH"}>|j5^xG2ɲ{v&S2Ox(mHlM##: rl ]=WQg`X=[v7˔οFjb8oѫէ́ܚMh =oѴh k X]vȱ(1xnV%[ I3rނW/J ,QgXN|RڨugI !<-p0&q .U`]ni iRM i3[Qۨ?#l!vvM{m_@[{ DvT8J4vC2N7K}Զx.gt'>Jpe:EZFn2^F᢯zC3dj,O"@>p<(Daep:^7=<⹙\q tnLA!|7D.ZJ˗^ddzDn|lC7@u[̳+0y>h10/iwuy"ޔG2>ـK)ځ6c/ Þ|(JG<)M):u^r/l2S\A?Ki@n3Ƶ+6҄1o4Rq~4/e8PO+ǔގ>NTRP$cd@fƽaJ%P*љ- >FN18 w *[P!{yκd+8WgKD`>:0gvG>tXc@'tS ܔ/-}=~lԊM.; |D]! !je>hl747,YQ8(" z16+zvO1 ;e<+4bԣ.2ުU蠝$ݘL'6ɁkO }(\[_kE7. 7 C,KPAL"Tf{KC]C>*B~E+ +<Pd=JFIoj@~j _ n7g#AC֯C?wNzyZw m"mêE-~T CW i1)͘!tRs:._v)Ɵpb>1iM8_b碥KO endstream endobj 77 0 obj << /Descent -225 /StemV 148 /Ascent 706 /FontName /ICHJDL+Garamond-Bold /ItalicAngle 0 /CharSet (/one/c/i/h/s/T/n/e/u/q/two/C/a/r/g/space/f/o/E/m/b/y/d/L/v/three/four/D/l/p/t/five/six/seven/M/Q/U/I/P/N/A/G/S/W/R/O/H/V/emdash/Z/B/hyphen/Y/colon/eight) /StemH 36 /FontBBox [-124 -250 1247 845] /Type /FontDescriptor /CapHeight 623 /Flags 262150 /FontFile3 78 0 R /XHeight 457 >> endobj 74 0 obj << /Encoding 75 0 R /ToUnicode 76 0 R /Widths [280 280 280 280 280 280 280 280 280 280 280 280 280 300 280 280 280 560 560 560 560 560 560 560 560 280 280 280 280 280 280 280 280 660 640 660 760 600 280 720 780 360 280 280 540 860 720 760 600 760 660 520 600 700 640 940 280 680 620 280 280 280 280 280 280 520 600 500 600 520 360 540 660 320 280 280 320 940 660 600 640 600 460 460 340 600 540 280 280 560 280 280 280 280 280 280 280 280 280 280 1000] /Subtype /Type1 /Type /Font /FirstChar 32 /LastChar 132 /FontDescriptor 77 0 R /BaseFont /ICHJDL+Garamond-Bold >> endobj 80 0 obj << /Type /Encoding /Differences [32 /space 40 /parenleft /parenright 44 /comma /hyphen /period 48 /zero /one /two /three /four /five /six /seven /eight /nine /colon /semicolon 65 /A /B /C /D /E /F /G /H /I /J /K /L /M /N /O /P 82 /R /S /T /U 87 /W 89 /Y 97 /a /b /c /d /e /f /g /h /i /j /k /l /m /n /o /p /q /r /s /t /u /v /w /x /y /z 132 /emdash 141 /quotedblleft /quotedblright 144 /quoteright 176 /degree] >> endobj 81 0 obj << /Filter /FlateDecode /Length 315 >> stream HTQn0{Ly%!Bj*qCMһːC6M[$x4uؘ~Fuhxq so IAj^N~U hpfӍPx4+~W cr p 43PUD,ğjRNJN3B--hZ m>BgǴ'\K&9}0m}YgQʴF&"cD>&&3)(%b;-wp[ 8~[IomG} 0^g endstream endobj 83 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 9037 >> stream HTitalX1KCYZ `\0aOZeU$ﲭuFH[^0F!@|{8 -! 6PwǏs9'޿ca썛a,VU){mFSOsPUӫKu\\Uy˔%%ʝSuʝjZ[%FwoTBRԪ ZuRUKUb&_e*}LU][W媕  7Ņa3c)* ac؆9X!UcaG1qm0 `x^.lnXd,;262++*/ZmUc%Ict*HΈq11#KYVvYٍdSD,$zs$7 j2A98o἞})/Iݑ^OL{S*E"LxӲn!bcEeuU:}G]7u>E;WIzuPF߹𘔢Ii5>`nr=D33(>8>xyqY$=b!=Ԋ@"ڌ2QL*{hf- c |g!B+h㷓P֎$#J`OӢ}S#^ޥt;:,v|/8 {oI`)iv4+Z} cGfYD,vʤaM0)5=0@G"}Ғ*mEyH74tC>a0+rة9hG|f܃Ey93aH@ڌ ĈpJ: ߊĬ:[M!H%蝳GbS\{[#Wr%:9tdQ4Fmysv=\A{(XFqx %B r/dۚb1S_FVY~,Y'OSR$[y<}ɏ. A1ȈڷA[u?k04VO  9W ë[9!4 r6JV|t:ysBArSOgeT(zݼ%DG"Vt4mqfvi}[1Ma l d(l,T`u%|ҟIFIS &eC$+G)oIm=!^ph5+Wn؅<&FXo)'wwB\[|wCO+nY뛟={-xu֤!< {ϠMCCX֢i(jb6u`Td]Г{7 *4edJ0cD(+#zB4/́?ҟy7[T6oۗP/?;apv\ myoʇإ7A tk_-o"FURHئe;7~k= /RZ2@w̪ \Z'gK p&J3ٮzE16 2>\aFyC"Jnn[8}"tR])d6s>էQE}NeUI*k4ݰ uGYyXClsCׂV 2($n&X.n[Qሀ]t3i'`e㿞QwWoGp4fEŃ1J!INDrN eV?q@s)݊;nnSuKfT# d^/XJw?bC8Ax' uІ=\Sh7՛ hG4×dЅ 8RK5|Bci-&sbX,Y̼_ ԕ<.cρag=4ݷ+n:b|S 9lvoJ[̵Kbd/ksjcܭ[!WuH[1 |CO5 hd[wASh6ux`Gf{[\vŘRԠCsVҀ+H%fve% c~FJ#`aRMsSnl3>v G¾١p&+:\_+pEn /\%\C+63HT㪊wQZ=z.)oJrIrFMpNj)oYG/nwD^d9MȶvZ2XZЧ~_a) ?&kII8%X@GL[Ff9ݹ`tϾLpiC4 p-MꃉI {'r~`o@nu}yocBGv9!ʈ_̬7%_91xW%7TK*rv/eqqeY Afn**C!E61p!$!{gvfgfgv.bY[@$ 07 $6GP)Leu .3u{;:p>Ic Tht{6% 4UOI \I IZ.\I: p-mFp+t~bS'Sn 6jA6u>;2K!<%LbE s]U2d3N/]O߸|< !6DD5u[ 0`-lyr/A xeQ W.[9|킕|XQ$k li<];$HfRi昩WO?"I:d:ꋴJ0bu6֮Nm=0nPe7Y;˴<=bYʌQK;zA)cf.YgNt3'+_aUf} \f\Ub'kSCLqab݌sBmJ!6=ORT@hDZVr֦G |h`w6O>xY4r~Y*d $h_ˈ>2 {=xREytK@qhUa'aש'HHoHoF.Df r( { 6Q{%k|<֢=D:pIun}2΢ޡGh/e2◑ t[9J J 섮2n+fՍŚp*P  2퇸R! Rv-Q9D pqs[ԑ˵!a/N~W9|/=>605 ')%eWu޾@6}bCDW9 n'砷m{jvma&,A-`z }P{u|Zsp.EcNh7\#&{@;(~Q >h:X{3⅘}/o] z=M.z DRl;upQ]Gr`j2r*"kSBLD@t;}0,_442_ n)qNrtˬoZbo ֑|Z?GO^qqWaXAXt?0m2sbƇwjK;_C87gHI o+q(`#nNhPj“=(Ddz(ֿYo$?4iFv=ϓK8<6IG'~3vJ.x/e}hVԉ ?Z̦cr̴"S(xu\b[rZ3.Y`zȯ(0i(ag8e r<ؒ b$葷a"OQxr7ĨfMv|Wil,Ίz=S}C(ҦJ!hk0Ř`1/|ݙ=ޙcv`p B CT%TJH-跆PPVi}{yy>J 4g9k#{v!Z,yh5,핥ՠ- Ψ\(~_OB1ԏxkֺ֓ARFP26D`sոټFփB;E/HёRw\ɽYGAwT={kaf*̺~ H: "=L^=8-Ȝ]Fr{ \=iJtJ|w쪺py7}xڹu#>'ydr?ETnf~SFb òH +ĄeV($D΃ RDW0,v=cɉ6w@ hCb$-{i[u'}ǭM7^}ǟXxݒ ;Т& j `@UzҔ .{_QTןl&?lj^^][rݍ4 :YV z\FjQnYNýB)JZ&ӲO"$Jrj'gs->Zjpr͸q:*@8 q~sw/9P˳' V3SI˴DUkf?+ `u% {!(eHl7&ԎM%`yrRXg6ݦǧ" *3 H+猘4j#O[Ҝ,' *D V;2eō]9t3⮨P%AQ̭Y[W 0T䨠;o hDP ă$|~tUEj~{6M:iM.m ,00yn';s3m+b#Q<ǻr_~#Ҵ" 3..lZf|U  ƃJ6wRä*ń_- ""(fUW6QL@{ZF'FdOC:><8v4ބmS)3^Ph(GʅB&ʫ)a#f`[F[~%(U.mt1BGGcoEvû'Խ&QR"J+djh-n)jNI4;y'R ԳWHϴ)v9d<_-UYVTpӁ h9꒼j+j=nj:0J.eo+,6f杁%(.laDj𥄊z 0|k/h?;?U퇙R<(A CPPCPqr>=_+jB ;"6Jla| \BinDn4~WLt=:7mvSlK_IhLNQƭR7@p#cp"qgiT[ 'TD+#L؆prFC<(YF%p" K5ü!̟C 3@*jJ,#S31.F8&"}bX)%8>AϠiNYK丄HÏM_^/(2K0Jε6׷8;s?G=1(/`*߃`!O;l-Rp\u蓱Xytw7PSPD\D*Ȋ> endobj 79 0 obj << /Encoding 80 0 R /ToUnicode 81 0 R /Widths [265 265 265 265 265 265 265 265 358 358 265 265 265 218 265 265 530 530 530 530 530 530 530 530 530 530 265 265 265 265 265 265 265 617 579 645 711 528 502 707 706 316 325 688 494 807 718 751 547 265 603 460 589 679 265 933 265 651 265 265 265 265 265 265 265 448 555 493 545 492 306 504 565 264 253 519 260 824 559 546 581 550 367 393 321 549 490 803 556 480 442 265 265 265 265 265 265 265 265 265 1000 265 265 265 265 265 265 265 265 418 418 265 269 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 265 400] /Subtype /Type1 /Type /Font /FirstChar 32 /LastChar 176 /FontDescriptor 82 0 R /BaseFont /ICHJBK+Garamond-Book >> endobj 85 0 obj << /Type /Encoding /Differences [32 /space 40 /parenleft /parenright 46 /period 49 /one /two /three 65 /A /B 68 /D /E /F /G 73 /I 76 /L 79 /O 82 /R /S /T /U 89 /Y 97 /a /b /c /d /e /f /g /h /i 108 /l /m /n /o /p 114 /r /s /t 118 /v 121 /y /z] >> endobj 86 0 obj << /Filter /FlateDecode /Length 330 >> stream HTRMo0 +|dHiV}hmwtH#DgǬې/~nv;Qq7i8pso NW43UfwՃtAZt9?_ 5湱/̀QWs18FkJ*Ԁ (Nl\ QD0 ~"!ows9F 撽%䞂Q4& Lቌ %DEٙR9!`I!I ܮ*gI,Q2&ʥc;@_{aGc7`sq@ endstream endobj 88 0 obj << /Subtype /Type1C /Filter /FlateDecode /Length 2817 >> stream H\U PWꈴ nQC!("0qFAP1DeC"n(`xD\QHb*Aw=17XoVUu|}˨ ˲S'M3=`5#Ϛbe:xVx`\5 n8k@;`=lY%i94nlXs _9qT*%dX3Sl,ݜcM iB4ۚmѷ#gKf)nNf$b)>}- *ż'٥tkNOM7ӭaŸ qW0,3\&aF3%0ZfIT0I F3F`L$˔0GY-=V;c eKU:UBfqjm@M.\Ǹf~N?aBޫX{|pSXfR|I0`Lc !fVkE1eSxF n?р$=$Bpbc/Q KHtRM\тkAR^ yWRԐLFAMNW xA2(#TIYcÕ$ crŁk~stzEztR>`y$}/xx4¼9 |#HKсdwVhGDw&Fҁf;ؿF)!FǑj'XkQc -j!0M>͗n<4Rs` 90rox9#v=sN}ε1N_ղ8%C"ស9k^+b< p򕆂sf0Z!HI\"S7xE7|ɥ+1 ]-8u"]y1p>sQO{-|>op DD9K~<\W4ak9.4)yF 8Af<'8<kK<r}[M% 2dq0Q\3xmk<"rLO]M^t4T m[o?oQʛ0`5<ޅ2˃Pv],;e+9 d>.$,PEӯMA"# "T,SdYez/9s=M}k DT*O%hLY&|ڠh_HÏ\wC0.BV5%7 \N:ܺ;}ەsY9qY@еy&ͦ.a1T+@%vgV''FCOǍ͂Sy(K`L*w'vf_N._:{{E'A}$5ȩ4L͎Xۭ+b.lUu!.U9*H 03Kݑ|}Rt[X&( ![f$ȔV6J7!%o$fR&PG)/_vЙ3 k{JOcjq=3ɾ7I_XW J*y{b$0* !d7Jhy'm+jDGV&Lt4s`1>6M0cFypۜFIL{"^!N6̶ŢhH+G@f]uLݾ3ХsʩvR#<r>0/ kuulN.$+T巯iRZRn@eC@u\5p_NB[0=S+\.܏' qy.AvgM>*(%f fe%H\ HoIDssq:=%^]m2^^Jo7dbg@[ A5^I v+ T AP &)>0( 3CWndٜYުUNR{Ԟ!bnX,Yeb.xUUηbmbʆe,UqւR u(i}Y& endstream endobj 87 0 obj << /Descent -207 /StemV 140 /Ascent 718 /FontName /ICHJAK+Helvetica-Bold /ItalicAngle 0 /CharSet (/t/U/y/L/d/Y/c/i/D/m/h/s/v/a/space/T/f/A/E/O/F/e/n/p/r/S/z/o/B/R/l/one/period/parenleft/parenright/g/b/I/G/two/three) /StemH 140 /FontBBox [-170 -228 1003 962] /Type /FontDescriptor /CapHeight 718 /Flags 262148 /FontFile3 88 0 R /XHeight 532 >> endobj 84 0 obj << /Encoding 85 0 R /ToUnicode 86 0 R /Widths [278 278 278 278 278 278 278 278 333 333 278 278 278 278 278 278 278 556 556 556 278 278 278 278 278 278 278 278 278 278 278 278 278 722 722 278 722 667 611 778 278 278 278 278 611 278 278 778 278 278 722 667 611 722 278 278 278 667 278 278 278 278 278 278 278 556 611 556 611 556 333 611 611 278 278 278 278 889 611 611 611 278 389 556 333 278 556 278 278 556 500] /Subtype /Type1 /Type /Font /FirstChar 32 /LastChar 122 /FontDescriptor 87 0 R /BaseFont /ICHJAK+Helvetica-Bold >> endobj 89 0 obj << /Subtype /Image /DecodeParms << /K -1 /Columns 201 >> /Type /XObject /ImageMask true /Filter /CCITTFaxDecode /Width 201 /Height 190 /Length 673 /BitsPerComponent 1 >> stream %3}n0vma~wmannݲ;m#M mmve܂%l6 adx̡0abpppz!oA6-m ~mMVۭ6(M6Ҷm)hm=6hn~զwXmVmm56ۻmmNo am}#ov}^6mz mnM=m]۾npmݽ{m_ݶݶwoaۻ ~mwMU-Wnn{v}o/ݾ߷Wm{znvowP}ޫFO}i7kiz^އ'XD1ߪ#@hg֤A]|{Pm5y޳vx!uj _5}kKl}qhW݅^U턖% FڥE J؈Ii+C([# d3[aK`P!C"'VC2"2  XeG endstream endobj 90 0 obj << /BG2 /Default /SA false /OPM 0 /UCR2 /Default /Type /ExtGState /SM 0.02 /TR2 /Default /OP true /op true >> endobj 91 0 obj << /BG2 /Default /SA false /OPM 0 /UCR2 /Default /Type /ExtGState /SM 0.02 /TR2 /Default /OP false /op false >> endobj 93 0 obj << /FunctionType 4 /Range [0 1 0 1 0 1 0 1] /Filter /FlateDecode /Length 20 /Domain [0 1] >> stream HN)-PZ.( endstream endobj 92 0 obj [/Separation /All /DeviceCMYK 93 0 R] endobj 68 0 obj << /Font << /F6 69 0 R /F5 74 0 R /F4 79 0 R /F3 84 0 R /F2 39 0 R /F1 43 0 R >> /ProcSet [/PDF /Text /ImageB] /XObject << /Im1 89 0 R >> /ExtGState << /GS2 90 0 R /GS1 91 0 R >> /ColorSpace << /Cs8 92 0 R >> >> endobj 94 0 obj << /Filter /FlateDecode /Length 2761 >> stream HWK۸{Rddn~'fGEIEƓ=T3 |qޗu>T_˗]UANJk A뭣(OQ&HE'sus+hc.qvڿ''̭4+WW{)v/{PSΟ__˺;T?B ˎ|ƊWm) -{+ԏ\8Tu쇪yXߓ,uBu[-Yş|\W]]Ǟ@o' |щD@?҇_8wj ׎PُvDn{Cn{~b۱Ke6k1MέBEV~,nOze*g$ x|qV_Dʄ~=/:RP&?NxZf#ΓFgez1gJF)F}5 $LsyP=#"ʯvn}+P)F*c ~Ӥڴ}φ8oĠli@ݧ@MGF6CK5Ѫ>q}llI1!?vye3fvo,eρ5BBmnfb$TS2wGU芲KM{\tMI[`5@.FIǡ4tYg_I]CtPav}Jı yՖ4Dg2jB%63;޺&8$Z粁UL7;ЉF{Ć 5'7(G=PգaͰr;og `7݀N5p4*jeb()f4CNww;a°K2Vcyc1QX7j }uq`X=U&,^R~avl-%Y^E*;UvWT{^S]5Ua IAZ־iM49;*u:kНq~QqscjMF c[ OYZdTϰ>^"=>4}NhksjNrdz2)rad)M:5ZѩWj)2~ҭizsZqI13Ez31WZbbZHCط՗|P{'4ޟj$E6a]~͜gsOSDtoU5I&?ڏk9(S!9T 33bfW]Ĝ1]ƜwG?jY/GfXn ,{12q\'18I_zL}yX$jmI:QEg>Ժg)kYM՟g_"l&<, 6 w l"9A;xN+-`KnDB;J-U[iWgĕpV\W\[6'X{V`酁ͤLm^͞F9k|1}dn -wo6Z*7 ~eJ3S̈~c_nz]S?oјSpd7ȷ))!TcCSOZw6'EԘJLk&S0ԬT']_BҁS/n&0F0,l/Jhh3Utu "xnRwg|ۧEOjk5.MnqBNs@ {]S73{-e/X)䖏`jqxvSB$벅J`<usF`ԠUMbZdE.@u;S#58$/3mR8f,oT|ݪ83׫](- g"alxb6 zFh`{hq̹^v!Qt  +RX*_&X F|+ >;W7v#ѫ8O"A` :Kgk7A(Ӊ^D/($%Nf8WoA:! T gGiQ(rtX+lH)AFHۈ}8VÎD2ђ:C#M=0,gvn:W/^ۗeRߘv4!ƾv.[)Yq ӌ}sa[ @aL U2bh)X<cd_GWS耓lj~Yz3W.>{qn22ڟ~tQeF{HBmEFR50Z.#XJ1P E BFYAVcbP^aϱù>߁p|wFƯ,J/Һb흑D*A@̲[!n[罚mGJI ؐԽՋ~'؏d endstream endobj 97 0 obj << /Filter [/ASCII85Decode /LZWDecode] /Length 481 >> stream J,g]g+e/h_!_gCtO=0f)$P%cIi8Zdfc5&3j_8$7g.@L`YKUJNGBP\poR=_;Dl'P(T (7Boo^^S:71(MN]ZQX/+Cbu.lK"p74pe1T%s.DY%&\1TdJhr54.M9au6>79n6`Q:4 PbLSZTLEE(8E@'*1mg_*eTnN*;*'V3+gm-EEetX%;Bo$ur2ss*N`.-!.kG_q6GDD' dKoL!8Ka#EV,@V!\j8ZFbp6EE<9cn=N6j0nf;(&;QU6bUD')c@\ 9-d\DA=cZ0Q>gIM$$;cd2O@&a;X,Nn_aP(]I1aRc(K1^ue> gF/(+GaKo$qneLWDrQ#;5\S(\$q'4Q,85`-8;S(=Z"WSBOV*FM)4,?B],R endstream endobj 96 0 obj [/Indexed /DeviceRGB 255 97 0 R] endobj 95 0 obj << /Width 76 /Filter [/ASCII85Decode /FlateDecode] /Height 99 /Length 497 /BitsPerComponent 8 /ColorSpace 96 0 R >> stream 8;Z\6>IK/,$tM0mb1>s+ZCT0C`'@31_:p#cU51c,NJ?1_PJ7:=Pg%6 Kgg=`s)bLkB=Zj8op^]f3rZF6!iHsHMXGkFG-'G*gA<,E:@gXgRj.O]@0ZCVP9?VB =)XA=F1#%t%VK&0-QCE"TAa8U6sR\MR-Q.:jf^tQIflk[;CWEh^:tjA1JgXq.VlLE hYYgcfSl[L1!+QSM,NJAD;@)SP;,itk4G?f$dBc[A (NOHMpYj5Z?lc0\Suj9%e5,E'SETh\<%@W6D(+h5ik0#YF]C'8`[+P2S<;JHB;4sY ]uK'CeaDKq4lVH\Vsl3D)B0!4!s!W/1,/~> endstream endobj 67 0 obj << /Resources 68 0 R /TrimBox [44 44 656 836] /Type /Page /Parent 1 0 R /Contents 94 0 R /Thumb 95 0 R /MediaBox [0 0 612 792] /CropBox [0 0 612 792] >> endobj 1 0 obj << /Kids [3 0 R 17 0 R 62 0 R 67 0 R] /Type /Pages /Count 4 >> endobj 98 0 obj << /Type /Catalog /Pages 1 0 R >> endobj 99 0 obj << /ModDate (D:20170713211150+02'00') /CreationDate (D:20170713211150+02'00') /Creator (pdftk 2.01 - www.pdftk.com) /Producer (itext-paulo-155 \(itextpdf.sf.net-lowagie.com\)) >> endobj xref 0 100 0000000000 65535 f 0000555342 00000 n 0000000000 65535 f 0000451851 00000 n 0000040437 00000 n 0000040152 00000 n 0000000037 00000 n 0000000015 00000 n 0000070276 00000 n 0000069980 00000 n 0000041545 00000 n 0000041522 00000 n 0000071372 00000 n 0000071410 00000 n 0000450776 00000 n 0000451795 00000 n 0000000000 65535 f 0000515582 00000 n 0000509065 00000 n 0000460729 00000 n 0000452045 00000 n 0000452114 00000 n 0000460335 00000 n 0000452421 00000 n 0000470164 00000 n 0000460966 00000 n 0000461103 00000 n 0000469773 00000 n 0000461468 00000 n 0000480646 00000 n 0000470706 00000 n 0000471082 00000 n 0000480181 00000 n 0000471480 00000 n 0000484954 00000 n 0000481278 00000 n 0000481368 00000 n 0000484601 00000 n 0000481701 00000 n 0000495798 00000 n 0000485275 00000 n 0000495570 00000 n 0000485468 00000 n 0000507405 00000 n 0000507174 00000 n 0000496985 00000 n 0000508602 00000 n 0000508730 00000 n 0000509010 00000 n 0000508860 00000 n 0000509263 00000 n 0000510031 00000 n 0000510788 00000 n 0000511547 00000 n 0000512273 00000 n 0000513021 00000 n 0000513703 00000 n 0000514151 00000 n 0000515098 00000 n 0000515048 00000 n 0000514476 00000 n 0000000000 65535 f 0000520197 00000 n 0000515804 00000 n 0000515991 00000 n 0000519698 00000 n 0000000000 65535 f 0000555171 00000 n 0000550827 00000 n 0000523862 00000 n 0000520368 00000 n 0000520514 00000 n 0000523573 00000 n 0000520882 00000 n 0000533201 00000 n 0000524412 00000 n 0000524713 00000 n 0000532806 00000 n 0000525099 00000 n 0000544235 00000 n 0000533786 00000 n 0000534216 00000 n 0000543738 00000 n 0000534607 00000 n 0000548938 00000 n 0000544996 00000 n 0000545260 00000 n 0000548577 00000 n 0000545666 00000 n 0000549483 00000 n 0000550364 00000 n 0000550492 00000 n 0000550772 00000 n 0000550622 00000 n 0000551061 00000 n 0000554521 00000 n 0000554471 00000 n 0000553899 00000 n 0000555422 00000 n 0000555474 00000 n trailer << /Info 99 0 R /ID [<39ee9f1edd7e63109b30fc944f29f36f><618f50e9b240adc3094a1621318bba28>] /Root 98 0 R /Size 100 >> startxref 555670 %%EOF